Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2M126

Protein Details
Accession A0A0D2M126    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKPVARGRPERRRRTATVTHPDRBasic
NLS Segment(s)
PositionSequence
8-14GRPERRR
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MGKPVARGRPERRRRTATVTHPDRGVTAAFPRGKDMNRAPGGAQQFPPPMTFSPPEAPRKRTSSFSCAVPPSPRPAKALRRSETLLSFADALPPSSSPCATAALPAVPYHRTLQFYKDQRLKRKALSRAGEPLAICTVPVPITTTTPIAAPIAPVVAAPTPKPTAPLRLRRPSHAPQVVLPSVESPITTLLSPRASSPLAPTPPAVRPPRPVFPRARAPPDLYRAALRGRMAGSPEGRRVLLMGARLALSIDAATKELERIVADHRDGDCVMADGTGASMGMGVGMGMGGMSGAMGTGTGAPAPPVLTASWVVVKGEDWEMVDCAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.81
4 0.81
5 0.81
6 0.78
7 0.72
8 0.65
9 0.59
10 0.51
11 0.42
12 0.33
13 0.24
14 0.2
15 0.25
16 0.26
17 0.26
18 0.29
19 0.33
20 0.33
21 0.39
22 0.41
23 0.43
24 0.43
25 0.44
26 0.4
27 0.42
28 0.44
29 0.4
30 0.36
31 0.31
32 0.31
33 0.3
34 0.3
35 0.27
36 0.24
37 0.25
38 0.26
39 0.25
40 0.3
41 0.36
42 0.46
43 0.49
44 0.53
45 0.54
46 0.58
47 0.57
48 0.57
49 0.56
50 0.54
51 0.51
52 0.49
53 0.49
54 0.46
55 0.46
56 0.43
57 0.39
58 0.4
59 0.43
60 0.41
61 0.39
62 0.45
63 0.52
64 0.57
65 0.64
66 0.59
67 0.59
68 0.59
69 0.59
70 0.53
71 0.45
72 0.36
73 0.27
74 0.24
75 0.19
76 0.2
77 0.16
78 0.16
79 0.13
80 0.13
81 0.13
82 0.13
83 0.13
84 0.1
85 0.11
86 0.12
87 0.12
88 0.12
89 0.12
90 0.12
91 0.12
92 0.12
93 0.13
94 0.11
95 0.13
96 0.14
97 0.16
98 0.18
99 0.19
100 0.23
101 0.3
102 0.35
103 0.41
104 0.47
105 0.51
106 0.57
107 0.64
108 0.63
109 0.62
110 0.65
111 0.65
112 0.65
113 0.62
114 0.55
115 0.54
116 0.51
117 0.46
118 0.37
119 0.3
120 0.23
121 0.19
122 0.15
123 0.09
124 0.08
125 0.06
126 0.07
127 0.08
128 0.07
129 0.08
130 0.1
131 0.1
132 0.1
133 0.09
134 0.1
135 0.08
136 0.07
137 0.06
138 0.05
139 0.05
140 0.05
141 0.04
142 0.04
143 0.05
144 0.05
145 0.05
146 0.08
147 0.09
148 0.09
149 0.12
150 0.12
151 0.2
152 0.27
153 0.37
154 0.43
155 0.51
156 0.53
157 0.54
158 0.6
159 0.56
160 0.59
161 0.53
162 0.45
163 0.37
164 0.42
165 0.38
166 0.31
167 0.26
168 0.17
169 0.14
170 0.13
171 0.11
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.08
178 0.09
179 0.1
180 0.1
181 0.12
182 0.11
183 0.12
184 0.15
185 0.2
186 0.2
187 0.2
188 0.21
189 0.21
190 0.23
191 0.31
192 0.32
193 0.28
194 0.34
195 0.39
196 0.46
197 0.47
198 0.51
199 0.49
200 0.51
201 0.59
202 0.57
203 0.59
204 0.53
205 0.54
206 0.54
207 0.53
208 0.49
209 0.4
210 0.35
211 0.3
212 0.29
213 0.27
214 0.22
215 0.18
216 0.17
217 0.17
218 0.18
219 0.2
220 0.22
221 0.23
222 0.25
223 0.25
224 0.23
225 0.22
226 0.2
227 0.19
228 0.17
229 0.15
230 0.12
231 0.11
232 0.11
233 0.11
234 0.11
235 0.09
236 0.07
237 0.05
238 0.06
239 0.06
240 0.06
241 0.07
242 0.07
243 0.08
244 0.08
245 0.08
246 0.08
247 0.09
248 0.13
249 0.17
250 0.17
251 0.21
252 0.21
253 0.23
254 0.22
255 0.21
256 0.17
257 0.14
258 0.13
259 0.09
260 0.08
261 0.06
262 0.06
263 0.05
264 0.04
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.02
271 0.02
272 0.02
273 0.02
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.02
280 0.02
281 0.02
282 0.02
283 0.03
284 0.03
285 0.04
286 0.04
287 0.05
288 0.05
289 0.06
290 0.07
291 0.07
292 0.08
293 0.08
294 0.1
295 0.11
296 0.13
297 0.15
298 0.15
299 0.15
300 0.15
301 0.15
302 0.16
303 0.17
304 0.16
305 0.14
306 0.15