Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DVR3

Protein Details
Accession E9DVR3   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-96DEERRGRERVRRHYKGSKNHRQBasic
NLS Segment(s)
PositionSequence
78-95RRGRERVRRHYKGSKNHR
Subcellular Location(s) nucl 17, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
KEGG maw:MAC_01711  -  
Amino Acid Sequences MSPKQEPTYYLVPNMLALDSSAREVDLNSYAWIQPIVIDDEDLMFGGKSLSAWYEEDRRRLSSGSDDGRAEHSQDEERRGRERVRRHYKGSKNHRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.18
3 0.11
4 0.1
5 0.09
6 0.08
7 0.09
8 0.08
9 0.08
10 0.08
11 0.08
12 0.1
13 0.1
14 0.1
15 0.1
16 0.11
17 0.11
18 0.11
19 0.11
20 0.09
21 0.07
22 0.08
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.08
29 0.07
30 0.06
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.05
39 0.06
40 0.08
41 0.16
42 0.19
43 0.23
44 0.25
45 0.26
46 0.26
47 0.26
48 0.26
49 0.23
50 0.27
51 0.26
52 0.27
53 0.25
54 0.25
55 0.29
56 0.28
57 0.24
58 0.18
59 0.17
60 0.21
61 0.23
62 0.3
63 0.3
64 0.33
65 0.36
66 0.39
67 0.44
68 0.46
69 0.54
70 0.58
71 0.64
72 0.69
73 0.73
74 0.8
75 0.82
76 0.85