Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2MAT7

Protein Details
Accession A0A0D2MAT7   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
37-62FETHWQRYQRSHRRHWAPKSRHLARAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, cyto_nucl 6, nucl 5.5, cyto 5.5, plas 5, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDSLSMNSAARSYLLASLNCSLFLYVLLREHLLHFFETHWQRYQRSHRRHWAPKSRHLARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.17
5 0.19
6 0.18
7 0.18
8 0.17
9 0.12
10 0.09
11 0.09
12 0.08
13 0.06
14 0.07
15 0.07
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.16
25 0.19
26 0.21
27 0.26
28 0.28
29 0.29
30 0.38
31 0.48
32 0.51
33 0.57
34 0.64
35 0.69
36 0.77
37 0.85
38 0.87
39 0.87
40 0.85
41 0.86
42 0.87