Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2M5V3

Protein Details
Accession A0A0D2M5V3   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-78KLDSTEPRQSRRKRKEYWKSYHEGBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR032870  ALKBH7-like  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006974  P:DNA damage response  
GO:1902445  P:regulation of mitochondrial membrane permeability involved in programmed necrotic cell death  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
Amino Acid Sequences MLFLRILEQSQRWAYRIHARSYSAQSITRPCGFQLWPAYFSEAEQRMLLAASLYKLDSTEPRQSRRKRKEYWKSYHEGNTGTLTDLFAPDAMYDFHKGHFDGVIHDFREMHLSAWPLEEFPALKPVLERLHLLCPDPPSKIQTHLLHLASYGEILPHVDNLEASGTWILGVSLGDARTLRMKEIGGESGKEFSWKLPSGSVYLQRDRTRYEYLHSIDRISDESHSRAGQRLSIMIRDHYKDPQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.44
4 0.44
5 0.42
6 0.44
7 0.49
8 0.54
9 0.56
10 0.48
11 0.45
12 0.43
13 0.44
14 0.46
15 0.43
16 0.37
17 0.31
18 0.33
19 0.31
20 0.33
21 0.35
22 0.33
23 0.31
24 0.32
25 0.34
26 0.28
27 0.29
28 0.31
29 0.25
30 0.22
31 0.2
32 0.19
33 0.17
34 0.17
35 0.16
36 0.08
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.09
44 0.12
45 0.17
46 0.27
47 0.31
48 0.38
49 0.48
50 0.58
51 0.68
52 0.74
53 0.78
54 0.78
55 0.84
56 0.89
57 0.9
58 0.9
59 0.86
60 0.79
61 0.75
62 0.72
63 0.63
64 0.53
65 0.44
66 0.37
67 0.3
68 0.26
69 0.21
70 0.14
71 0.12
72 0.1
73 0.09
74 0.06
75 0.06
76 0.05
77 0.05
78 0.06
79 0.07
80 0.09
81 0.09
82 0.1
83 0.11
84 0.11
85 0.11
86 0.12
87 0.11
88 0.11
89 0.14
90 0.16
91 0.15
92 0.15
93 0.15
94 0.13
95 0.16
96 0.14
97 0.11
98 0.1
99 0.1
100 0.1
101 0.11
102 0.11
103 0.08
104 0.08
105 0.08
106 0.07
107 0.06
108 0.1
109 0.09
110 0.09
111 0.09
112 0.11
113 0.12
114 0.13
115 0.13
116 0.12
117 0.16
118 0.17
119 0.18
120 0.17
121 0.19
122 0.2
123 0.21
124 0.19
125 0.18
126 0.18
127 0.21
128 0.26
129 0.25
130 0.27
131 0.31
132 0.3
133 0.27
134 0.26
135 0.23
136 0.16
137 0.14
138 0.1
139 0.05
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.07
149 0.05
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.06
160 0.06
161 0.07
162 0.07
163 0.08
164 0.12
165 0.13
166 0.13
167 0.13
168 0.13
169 0.15
170 0.18
171 0.21
172 0.18
173 0.19
174 0.19
175 0.19
176 0.19
177 0.18
178 0.16
179 0.13
180 0.18
181 0.18
182 0.19
183 0.19
184 0.21
185 0.23
186 0.27
187 0.34
188 0.33
189 0.37
190 0.43
191 0.44
192 0.46
193 0.46
194 0.47
195 0.45
196 0.41
197 0.4
198 0.4
199 0.4
200 0.45
201 0.42
202 0.38
203 0.33
204 0.33
205 0.31
206 0.24
207 0.24
208 0.2
209 0.22
210 0.24
211 0.25
212 0.24
213 0.27
214 0.27
215 0.27
216 0.25
217 0.27
218 0.26
219 0.3
220 0.31
221 0.32
222 0.36
223 0.37
224 0.38