Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DZZ6

Protein Details
Accession E9DZZ6    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
293-318RGRTLSYGPRDKRKRWSVCGAERRGDBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
KEGG maw:MAC_03194  -  
Amino Acid Sequences MEPVPETERMEAFKSSPVPSLRLSSNPNAIPPLDLDMVRKPPTIRRSTDPNPTSPVSPSWSPSPSVALPYRPRTASPLSGGHSRSRSAASLASPMSRTQSMPGVSGSGRILYSPGLRPASPSNSGSPSRVRTPKKPVDEAFPATSPVRTSVLEQDKKQPDRSSSPVLGGAIVSSSRLRRSSSPFRSVPPPSSSALSLLPSPPSSVSSASSLRGYDALSASYGGSLSSIPSTPTSARSRSPSISSLETIPDSPDAEEAALEAEKSTQLKVAAEGADGGDSSDSKGRPPMDAPPRGRTLSYGPRDKRKRWSVCGAERRGDLDLETIWED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.31
4 0.31
5 0.31
6 0.32
7 0.35
8 0.33
9 0.35
10 0.38
11 0.37
12 0.42
13 0.4
14 0.4
15 0.37
16 0.35
17 0.3
18 0.25
19 0.25
20 0.2
21 0.19
22 0.2
23 0.23
24 0.29
25 0.3
26 0.32
27 0.29
28 0.35
29 0.44
30 0.49
31 0.48
32 0.48
33 0.55
34 0.59
35 0.68
36 0.63
37 0.57
38 0.55
39 0.52
40 0.48
41 0.41
42 0.37
43 0.32
44 0.3
45 0.29
46 0.28
47 0.28
48 0.28
49 0.27
50 0.29
51 0.24
52 0.28
53 0.27
54 0.3
55 0.35
56 0.39
57 0.43
58 0.39
59 0.39
60 0.39
61 0.41
62 0.38
63 0.35
64 0.34
65 0.32
66 0.37
67 0.38
68 0.38
69 0.35
70 0.32
71 0.29
72 0.27
73 0.24
74 0.21
75 0.21
76 0.17
77 0.19
78 0.18
79 0.18
80 0.17
81 0.17
82 0.18
83 0.17
84 0.16
85 0.14
86 0.18
87 0.17
88 0.17
89 0.17
90 0.16
91 0.15
92 0.16
93 0.15
94 0.11
95 0.1
96 0.09
97 0.09
98 0.08
99 0.11
100 0.11
101 0.15
102 0.16
103 0.16
104 0.18
105 0.22
106 0.25
107 0.26
108 0.26
109 0.24
110 0.27
111 0.28
112 0.28
113 0.28
114 0.27
115 0.31
116 0.38
117 0.4
118 0.43
119 0.51
120 0.57
121 0.6
122 0.62
123 0.56
124 0.54
125 0.54
126 0.51
127 0.44
128 0.36
129 0.32
130 0.26
131 0.25
132 0.18
133 0.15
134 0.13
135 0.11
136 0.12
137 0.18
138 0.27
139 0.31
140 0.31
141 0.39
142 0.45
143 0.47
144 0.49
145 0.44
146 0.38
147 0.4
148 0.43
149 0.4
150 0.33
151 0.31
152 0.28
153 0.26
154 0.22
155 0.16
156 0.11
157 0.06
158 0.05
159 0.05
160 0.05
161 0.06
162 0.08
163 0.09
164 0.11
165 0.14
166 0.23
167 0.33
168 0.38
169 0.45
170 0.44
171 0.46
172 0.51
173 0.5
174 0.46
175 0.39
176 0.35
177 0.29
178 0.29
179 0.26
180 0.21
181 0.2
182 0.16
183 0.13
184 0.12
185 0.12
186 0.1
187 0.11
188 0.1
189 0.1
190 0.11
191 0.11
192 0.12
193 0.14
194 0.15
195 0.15
196 0.16
197 0.14
198 0.13
199 0.13
200 0.12
201 0.1
202 0.09
203 0.09
204 0.08
205 0.08
206 0.08
207 0.07
208 0.07
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.06
215 0.07
216 0.08
217 0.1
218 0.11
219 0.17
220 0.21
221 0.23
222 0.26
223 0.3
224 0.34
225 0.34
226 0.37
227 0.34
228 0.33
229 0.33
230 0.31
231 0.27
232 0.25
233 0.23
234 0.2
235 0.18
236 0.16
237 0.14
238 0.12
239 0.12
240 0.1
241 0.09
242 0.08
243 0.07
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.08
250 0.09
251 0.09
252 0.1
253 0.11
254 0.12
255 0.13
256 0.15
257 0.14
258 0.14
259 0.14
260 0.11
261 0.11
262 0.1
263 0.09
264 0.06
265 0.06
266 0.08
267 0.12
268 0.12
269 0.13
270 0.18
271 0.19
272 0.21
273 0.23
274 0.31
275 0.37
276 0.46
277 0.5
278 0.51
279 0.55
280 0.55
281 0.53
282 0.46
283 0.45
284 0.46
285 0.5
286 0.54
287 0.55
288 0.64
289 0.73
290 0.76
291 0.79
292 0.79
293 0.8
294 0.78
295 0.82
296 0.81
297 0.83
298 0.87
299 0.83
300 0.78
301 0.7
302 0.64
303 0.55
304 0.45
305 0.35
306 0.27
307 0.21