Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PX48

Protein Details
Accession A0A0D2PX48    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-122MESMRKRPVRDNSEKPRDPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR022533  Cox20  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF12597  Cox20  
Amino Acid Sequences MSNEREPLSEAHVLPSRLPPPTGSLIQDSLQSARHIGDIPCARNAFLTGIVGGAGMGIIRGLSTSLMGAGHWAMGTCILLSVASWNICQYRFQQERTQLTQMMESMRKRPVRDNSEKPRDPSATAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.31
4 0.28
5 0.28
6 0.24
7 0.24
8 0.28
9 0.29
10 0.25
11 0.25
12 0.25
13 0.25
14 0.26
15 0.22
16 0.18
17 0.18
18 0.16
19 0.14
20 0.12
21 0.13
22 0.13
23 0.12
24 0.19
25 0.21
26 0.23
27 0.25
28 0.25
29 0.24
30 0.22
31 0.23
32 0.16
33 0.12
34 0.11
35 0.07
36 0.07
37 0.06
38 0.06
39 0.05
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.06
70 0.06
71 0.06
72 0.07
73 0.09
74 0.1
75 0.11
76 0.13
77 0.22
78 0.25
79 0.29
80 0.35
81 0.42
82 0.49
83 0.53
84 0.54
85 0.46
86 0.43
87 0.41
88 0.35
89 0.32
90 0.31
91 0.28
92 0.28
93 0.33
94 0.37
95 0.38
96 0.45
97 0.51
98 0.55
99 0.63
100 0.7
101 0.73
102 0.8
103 0.82
104 0.77
105 0.75
106 0.68
107 0.6