Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PM66

Protein Details
Accession A0A0D2PM66   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
119-148DGERDQRTVKPAKKKKAKKCNWTKRKKRKQBasic
NLS Segment(s)
PositionSequence
127-148VKPAKKKKAKKCNWTKRKKRKQ
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MAYAISGTPLDIVYSPPSSPESHLQDGYPDHSPSSSPYPESLSGNSSRSPSPIALYPLRPVFDWSRSRPDVLESVPDSLWYRPLSPPAKRHWFPLIPFKKEPAETPVNNASQAESPAVDGERDQRTVKPAKKKKAKKCNWTKRKKRKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.17
5 0.17
6 0.21
7 0.26
8 0.3
9 0.32
10 0.33
11 0.32
12 0.32
13 0.32
14 0.32
15 0.28
16 0.22
17 0.18
18 0.17
19 0.18
20 0.18
21 0.23
22 0.22
23 0.19
24 0.2
25 0.23
26 0.25
27 0.26
28 0.24
29 0.21
30 0.22
31 0.22
32 0.23
33 0.21
34 0.19
35 0.18
36 0.19
37 0.16
38 0.15
39 0.16
40 0.19
41 0.2
42 0.2
43 0.22
44 0.22
45 0.22
46 0.21
47 0.21
48 0.19
49 0.24
50 0.28
51 0.28
52 0.34
53 0.35
54 0.35
55 0.32
56 0.31
57 0.26
58 0.21
59 0.22
60 0.15
61 0.16
62 0.15
63 0.15
64 0.15
65 0.12
66 0.15
67 0.12
68 0.13
69 0.12
70 0.19
71 0.24
72 0.28
73 0.32
74 0.38
75 0.47
76 0.46
77 0.49
78 0.49
79 0.47
80 0.45
81 0.51
82 0.51
83 0.48
84 0.48
85 0.47
86 0.44
87 0.41
88 0.4
89 0.36
90 0.36
91 0.3
92 0.35
93 0.37
94 0.34
95 0.34
96 0.32
97 0.27
98 0.2
99 0.21
100 0.16
101 0.11
102 0.1
103 0.11
104 0.11
105 0.1
106 0.09
107 0.14
108 0.16
109 0.19
110 0.2
111 0.21
112 0.27
113 0.36
114 0.43
115 0.48
116 0.55
117 0.63
118 0.73
119 0.82
120 0.86
121 0.89
122 0.92
123 0.92
124 0.94
125 0.94
126 0.94
127 0.95
128 0.96