Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2M7S7

Protein Details
Accession A0A0D2M7S7    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-35CAPVHPRRSCSRRPPRTAARHGPRSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MRTSRSHTCCAPVHPRRSCSRRPPRTAARHGPRSPVTRRSLQGRIDTPVHAYTRNRADVWVPSPAPSAPSTRSLLCRRPACLDSQALSRSGLPPQASSVTHPSPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.69
4 0.73
5 0.75
6 0.76
7 0.78
8 0.78
9 0.79
10 0.83
11 0.83
12 0.86
13 0.86
14 0.86
15 0.84
16 0.84
17 0.77
18 0.74
19 0.69
20 0.66
21 0.62
22 0.59
23 0.53
24 0.49
25 0.5
26 0.5
27 0.5
28 0.47
29 0.47
30 0.41
31 0.4
32 0.36
33 0.33
34 0.29
35 0.26
36 0.23
37 0.2
38 0.18
39 0.19
40 0.22
41 0.24
42 0.21
43 0.19
44 0.2
45 0.2
46 0.22
47 0.22
48 0.18
49 0.17
50 0.18
51 0.17
52 0.18
53 0.16
54 0.17
55 0.14
56 0.18
57 0.19
58 0.2
59 0.27
60 0.3
61 0.36
62 0.41
63 0.42
64 0.41
65 0.45
66 0.44
67 0.41
68 0.4
69 0.38
70 0.32
71 0.33
72 0.32
73 0.27
74 0.27
75 0.24
76 0.21
77 0.2
78 0.22
79 0.18
80 0.18
81 0.2
82 0.23
83 0.22
84 0.25
85 0.3
86 0.3