Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KDG5

Protein Details
Accession A0A0D2KDG5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
53-75FELYEKRQARKKRKRETAIETVNHydrophilic
NLS Segment(s)
PositionSequence
60-69KRQARKKRKR
Subcellular Location(s) extr 7, cyto 5, cyto_nucl 5, nucl 3, E.R. 3, vacu 3, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MLPVLLGLSILCMAAQVCSGCNSXYGSERGLDFHQKTCDNFXDEDTSSNTIPNAFELYEKRQARKKRKRETAIETVNDEQIIVDPQPSPILHENPALVPPEPPIPEAIELSPAGRTVRKKRLTWKLLQQLPAAPTSIPDPPSAIXIDHNDAPPSIET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.07
5 0.09
6 0.11
7 0.1
8 0.11
9 0.14
10 0.16
11 0.21
12 0.21
13 0.2
14 0.19
15 0.21
16 0.23
17 0.29
18 0.28
19 0.26
20 0.3
21 0.31
22 0.32
23 0.35
24 0.35
25 0.3
26 0.29
27 0.26
28 0.26
29 0.24
30 0.25
31 0.23
32 0.2
33 0.17
34 0.16
35 0.15
36 0.11
37 0.11
38 0.1
39 0.08
40 0.09
41 0.12
42 0.17
43 0.25
44 0.27
45 0.3
46 0.36
47 0.45
48 0.55
49 0.63
50 0.68
51 0.7
52 0.79
53 0.84
54 0.85
55 0.83
56 0.82
57 0.77
58 0.68
59 0.6
60 0.5
61 0.42
62 0.34
63 0.26
64 0.15
65 0.09
66 0.08
67 0.06
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.1
74 0.12
75 0.14
76 0.15
77 0.16
78 0.16
79 0.15
80 0.17
81 0.15
82 0.12
83 0.11
84 0.1
85 0.13
86 0.13
87 0.13
88 0.13
89 0.13
90 0.13
91 0.14
92 0.13
93 0.12
94 0.11
95 0.11
96 0.11
97 0.1
98 0.1
99 0.13
100 0.2
101 0.26
102 0.36
103 0.43
104 0.48
105 0.57
106 0.67
107 0.7
108 0.72
109 0.74
110 0.74
111 0.72
112 0.71
113 0.63
114 0.56
115 0.51
116 0.44
117 0.34
118 0.24
119 0.19
120 0.18
121 0.2
122 0.17
123 0.16
124 0.16
125 0.16
126 0.18
127 0.19
128 0.18
129 0.16
130 0.19
131 0.21
132 0.22
133 0.23
134 0.2