Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P1G3

Protein Details
Accession A0A0D2P1G3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
137-159LGTLRERRERTHREPKEQEWRVDBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 6, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013860  AreA_GATA  
Pfam View protein in Pfam  
PF08550  DUF1752  
Amino Acid Sequences MSLVWFPAPAAPIDNDDDDIHPARSRRPSMPPAAPPPPRPPVLAVAPAALRALDGPDALAALWTVFAKCKSSLADGAQLENLAWRLWARELAAPDPHPALPSAAYPPYPSAMTMRGPALPDGWKTALGGVRTTLRALGTLRERRERTHREPKEQEWRVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.2
5 0.21
6 0.22
7 0.2
8 0.2
9 0.2
10 0.24
11 0.31
12 0.35
13 0.36
14 0.42
15 0.48
16 0.53
17 0.58
18 0.59
19 0.59
20 0.63
21 0.63
22 0.59
23 0.59
24 0.57
25 0.51
26 0.46
27 0.4
28 0.36
29 0.35
30 0.33
31 0.27
32 0.23
33 0.21
34 0.2
35 0.18
36 0.12
37 0.09
38 0.06
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.06
54 0.08
55 0.08
56 0.1
57 0.1
58 0.12
59 0.14
60 0.15
61 0.2
62 0.18
63 0.18
64 0.17
65 0.15
66 0.13
67 0.11
68 0.1
69 0.05
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.07
76 0.09
77 0.11
78 0.13
79 0.15
80 0.15
81 0.16
82 0.16
83 0.15
84 0.13
85 0.12
86 0.11
87 0.09
88 0.1
89 0.11
90 0.11
91 0.11
92 0.11
93 0.12
94 0.13
95 0.12
96 0.12
97 0.11
98 0.13
99 0.14
100 0.14
101 0.15
102 0.15
103 0.15
104 0.15
105 0.15
106 0.15
107 0.15
108 0.17
109 0.17
110 0.16
111 0.15
112 0.17
113 0.19
114 0.17
115 0.17
116 0.15
117 0.17
118 0.18
119 0.18
120 0.16
121 0.13
122 0.14
123 0.14
124 0.19
125 0.25
126 0.32
127 0.37
128 0.46
129 0.47
130 0.52
131 0.61
132 0.65
133 0.65
134 0.69
135 0.73
136 0.74
137 0.8
138 0.83
139 0.84
140 0.82