Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2NTS4

Protein Details
Accession A0A0D2NTS4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-56MYGCARPPAHSRKRVRKWGEMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGRAHTHTSLMTPWGRASLQCRRGVALREVAALNSMYGCARPPAHSRKRVRKWGEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.22
5 0.27
6 0.33
7 0.35
8 0.35
9 0.34
10 0.37
11 0.38
12 0.35
13 0.29
14 0.23
15 0.21
16 0.2
17 0.19
18 0.16
19 0.13
20 0.1
21 0.06
22 0.06
23 0.05
24 0.05
25 0.06
26 0.08
27 0.09
28 0.13
29 0.21
30 0.31
31 0.41
32 0.51
33 0.6
34 0.69
35 0.78
36 0.85