Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2M7C5

Protein Details
Accession A0A0D2M7C5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-71HLNLSHCRRPRKEHDSHRRKKCHGIBasic
NLS Segment(s)
PositionSequence
64-65RR
Subcellular Location(s) mito_nucl 10.666, nucl 10.5, mito 9.5, cyto_mito 8.833, cyto 6
Family & Domain DBs
Amino Acid Sequences MFKKGVEKGPSVECDLCGGMFVSPSSRFFGTPLSLAIDFDLSPACPHLNLSHCRRPRKEHDSHRRKKCHGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.21
4 0.15
5 0.13
6 0.08
7 0.08
8 0.08
9 0.08
10 0.09
11 0.1
12 0.13
13 0.13
14 0.13
15 0.13
16 0.15
17 0.14
18 0.13
19 0.12
20 0.12
21 0.11
22 0.11
23 0.11
24 0.09
25 0.07
26 0.07
27 0.07
28 0.05
29 0.05
30 0.06
31 0.06
32 0.05
33 0.06
34 0.1
35 0.16
36 0.22
37 0.3
38 0.39
39 0.46
40 0.55
41 0.6
42 0.65
43 0.69
44 0.72
45 0.75
46 0.77
47 0.81
48 0.84
49 0.89
50 0.91
51 0.91