Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NYT4

Protein Details
Accession A0A0D2NYT4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-58AAPRHTPRRACNRQRHLRTSHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 9
Family & Domain DBs
Amino Acid Sequences MAWSTSLSPAPACASQLPVCPRSIPGARARPRASGAAAAPRHTPRRACNRQRHLRTSHALGLGSLDTHTVTDTVGRHRSRDQRGGKSDGAAAAPHRGVCLILSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.26
4 0.29
5 0.28
6 0.28
7 0.27
8 0.27
9 0.29
10 0.3
11 0.28
12 0.32
13 0.4
14 0.45
15 0.52
16 0.53
17 0.5
18 0.49
19 0.46
20 0.39
21 0.31
22 0.26
23 0.27
24 0.26
25 0.24
26 0.25
27 0.27
28 0.3
29 0.3
30 0.31
31 0.29
32 0.4
33 0.49
34 0.56
35 0.63
36 0.69
37 0.77
38 0.81
39 0.81
40 0.74
41 0.69
42 0.63
43 0.56
44 0.49
45 0.4
46 0.33
47 0.27
48 0.23
49 0.17
50 0.14
51 0.1
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.07
59 0.08
60 0.13
61 0.21
62 0.22
63 0.24
64 0.31
65 0.4
66 0.45
67 0.54
68 0.57
69 0.59
70 0.64
71 0.68
72 0.62
73 0.55
74 0.49
75 0.4
76 0.33
77 0.25
78 0.2
79 0.18
80 0.18
81 0.16
82 0.15
83 0.14
84 0.13
85 0.12