Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KDJ3

Protein Details
Accession A0A0D2KDJ3   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-37ADNTHPLKEVPKKAKSRKADDAPPPPSHydrophilic
NLS Segment(s)
PositionSequence
21-31PKKAKSRKADD
45-45R
48-48K
51-55GRAKA
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MTKRKNLDDTADNTHPLKEVPKKAKSRKADDAPPPPSLPADGMRRVSKDQGRAKARNAPPVNIEAHRHLRHPAGRGVSHPTVTAIPPSSFYAAITRPVQPTRPVPLLDHPRRIAPVRQQGLTQXQPLNVASERLAQGLRDEVQTRPLRNDIQLSNLTRSLLAGGXGLPAPPLIPRRNTRATPSSPIXQRXSTVQLSDDDAMMDTTPDTYHHNLQFAEYQEPIHNTGHWQEGGYTDRGFMEEEYEDDDVFGTCQAPDPYYRGREYREGMAGPSREEFLPTNQDRSHFIKTKPRNRHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.29
4 0.31
5 0.32
6 0.39
7 0.46
8 0.55
9 0.64
10 0.73
11 0.82
12 0.83
13 0.83
14 0.83
15 0.83
16 0.83
17 0.82
18 0.82
19 0.76
20 0.71
21 0.64
22 0.54
23 0.46
24 0.37
25 0.3
26 0.26
27 0.28
28 0.29
29 0.32
30 0.35
31 0.37
32 0.39
33 0.44
34 0.44
35 0.47
36 0.5
37 0.55
38 0.61
39 0.62
40 0.64
41 0.66
42 0.64
43 0.65
44 0.6
45 0.53
46 0.46
47 0.46
48 0.45
49 0.37
50 0.37
51 0.32
52 0.39
53 0.38
54 0.37
55 0.35
56 0.38
57 0.39
58 0.4
59 0.39
60 0.36
61 0.35
62 0.36
63 0.41
64 0.36
65 0.32
66 0.28
67 0.24
68 0.2
69 0.2
70 0.2
71 0.15
72 0.13
73 0.14
74 0.16
75 0.16
76 0.14
77 0.14
78 0.15
79 0.14
80 0.17
81 0.18
82 0.19
83 0.21
84 0.22
85 0.24
86 0.24
87 0.27
88 0.29
89 0.3
90 0.28
91 0.27
92 0.34
93 0.42
94 0.44
95 0.46
96 0.42
97 0.4
98 0.41
99 0.42
100 0.38
101 0.36
102 0.4
103 0.37
104 0.37
105 0.36
106 0.37
107 0.41
108 0.4
109 0.32
110 0.23
111 0.21
112 0.21
113 0.22
114 0.19
115 0.13
116 0.1
117 0.11
118 0.11
119 0.11
120 0.1
121 0.09
122 0.09
123 0.1
124 0.1
125 0.09
126 0.1
127 0.09
128 0.17
129 0.2
130 0.21
131 0.21
132 0.23
133 0.22
134 0.22
135 0.26
136 0.18
137 0.2
138 0.23
139 0.23
140 0.22
141 0.22
142 0.21
143 0.17
144 0.16
145 0.12
146 0.08
147 0.07
148 0.05
149 0.05
150 0.05
151 0.06
152 0.05
153 0.05
154 0.05
155 0.06
156 0.09
157 0.11
158 0.16
159 0.19
160 0.26
161 0.32
162 0.34
163 0.38
164 0.42
165 0.44
166 0.44
167 0.46
168 0.48
169 0.44
170 0.45
171 0.42
172 0.36
173 0.35
174 0.33
175 0.3
176 0.23
177 0.2
178 0.2
179 0.18
180 0.16
181 0.14
182 0.11
183 0.08
184 0.07
185 0.07
186 0.05
187 0.05
188 0.05
189 0.06
190 0.09
191 0.12
192 0.18
193 0.19
194 0.22
195 0.21
196 0.23
197 0.26
198 0.24
199 0.24
200 0.18
201 0.18
202 0.18
203 0.2
204 0.21
205 0.18
206 0.16
207 0.15
208 0.17
209 0.2
210 0.18
211 0.16
212 0.14
213 0.16
214 0.19
215 0.19
216 0.17
217 0.14
218 0.14
219 0.14
220 0.15
221 0.12
222 0.12
223 0.1
224 0.1
225 0.13
226 0.13
227 0.12
228 0.11
229 0.12
230 0.09
231 0.09
232 0.09
233 0.06
234 0.06
235 0.1
236 0.11
237 0.12
238 0.13
239 0.18
240 0.24
241 0.28
242 0.32
243 0.32
244 0.36
245 0.41
246 0.43
247 0.44
248 0.42
249 0.38
250 0.37
251 0.4
252 0.37
253 0.32
254 0.3
255 0.26
256 0.22
257 0.24
258 0.23
259 0.21
260 0.31
261 0.31
262 0.36
263 0.36
264 0.38
265 0.4
266 0.44
267 0.49
268 0.46
269 0.49
270 0.54
271 0.63
272 0.71