Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2NK42

Protein Details
Accession A0A0D2NK42    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-101FSQSLRKVRSGRERRGRERSSGCHydrophilic
NLS Segment(s)
PositionSequence
87-95RSGRERRGR
Subcellular Location(s) plas 12, mito 7, E.R. 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTSYVLFLFHFTNNETRPIPYFSWLILISCITLYIHRQSSTSFSTCRILWNPIIVCVLRELVEKLGIELVEKLKWLAFSQSLRKVRSGRERRGRERSSGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.25
4 0.25
5 0.26
6 0.3
7 0.28
8 0.25
9 0.25
10 0.2
11 0.23
12 0.21
13 0.18
14 0.14
15 0.13
16 0.11
17 0.09
18 0.1
19 0.06
20 0.07
21 0.08
22 0.12
23 0.14
24 0.14
25 0.15
26 0.15
27 0.19
28 0.22
29 0.21
30 0.18
31 0.18
32 0.19
33 0.19
34 0.21
35 0.19
36 0.18
37 0.16
38 0.19
39 0.18
40 0.16
41 0.18
42 0.14
43 0.13
44 0.11
45 0.11
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.1
63 0.11
64 0.12
65 0.15
66 0.2
67 0.27
68 0.37
69 0.42
70 0.43
71 0.47
72 0.48
73 0.52
74 0.59
75 0.61
76 0.62
77 0.67
78 0.75
79 0.8
80 0.87
81 0.83