Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DRY2

Protein Details
Accession E9DRY2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-105LSEPPKPKPKPGTDKESKPSBasic
NLS Segment(s)
PositionSequence
91-97KPKPKPG
Subcellular Location(s) nucl 11, mito_nucl 10.333, cyto_nucl 9.333, mito 8.5, cyto 6.5
Family & Domain DBs
KEGG maw:MAC_00055  -  
maw:MAC_00056  -  
Amino Acid Sequences MSKDIPPQLSASLRIVELEDQVKGLMETVIQLHEMYGLEAINIPKPDKYVKKGGYTVTELQQRYARRPAPSATPVTTTATQETTVLSEPPKPKPKPGTDKESKPSPSWRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.16
5 0.15
6 0.13
7 0.11
8 0.11
9 0.11
10 0.1
11 0.09
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.07
27 0.08
28 0.09
29 0.1
30 0.1
31 0.1
32 0.12
33 0.18
34 0.21
35 0.25
36 0.31
37 0.34
38 0.37
39 0.4
40 0.4
41 0.37
42 0.36
43 0.34
44 0.29
45 0.31
46 0.27
47 0.26
48 0.28
49 0.26
50 0.27
51 0.32
52 0.31
53 0.28
54 0.3
55 0.31
56 0.33
57 0.36
58 0.35
59 0.3
60 0.29
61 0.29
62 0.3
63 0.3
64 0.25
65 0.22
66 0.2
67 0.18
68 0.16
69 0.14
70 0.12
71 0.12
72 0.12
73 0.11
74 0.17
75 0.21
76 0.3
77 0.39
78 0.4
79 0.47
80 0.56
81 0.65
82 0.69
83 0.73
84 0.75
85 0.74
86 0.81
87 0.8
88 0.8
89 0.73
90 0.67
91 0.69