Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2L5X9

Protein Details
Accession A0A0D2L5X9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-52AARGRRYYSCRRLLQRTCRPCPRDHydrophilic
140-163GGRVWDCVRSRRRRKYAVRCIFSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7, nucl 6
Family & Domain DBs
Amino Acid Sequences MPSPLPSLHMRPAARCTPPEGIGTRLWTAARGRRYYSCRRLLQRTCRPCPRDHAVPPPQPTKFDLDFPSPVVCTHVRLHRRCPPARTRASNVTRCAFDIWRCPLCRLGRPARPPADPTPTAAPRAAGRRGPDPLLRFFSGGRVWDCVRSRRRRKYAVRCIFSGVPFTARRTLADGAARWLEVGGRRFRRPVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.43
4 0.4
5 0.4
6 0.41
7 0.36
8 0.33
9 0.31
10 0.33
11 0.29
12 0.26
13 0.24
14 0.22
15 0.25
16 0.28
17 0.33
18 0.33
19 0.36
20 0.42
21 0.49
22 0.57
23 0.61
24 0.63
25 0.64
26 0.69
27 0.75
28 0.76
29 0.8
30 0.8
31 0.81
32 0.81
33 0.82
34 0.79
35 0.72
36 0.71
37 0.67
38 0.65
39 0.61
40 0.62
41 0.61
42 0.64
43 0.66
44 0.65
45 0.59
46 0.52
47 0.48
48 0.45
49 0.37
50 0.34
51 0.31
52 0.29
53 0.29
54 0.28
55 0.27
56 0.2
57 0.19
58 0.18
59 0.15
60 0.15
61 0.17
62 0.24
63 0.31
64 0.33
65 0.4
66 0.45
67 0.53
68 0.54
69 0.57
70 0.58
71 0.59
72 0.65
73 0.63
74 0.6
75 0.61
76 0.65
77 0.64
78 0.59
79 0.51
80 0.44
81 0.39
82 0.36
83 0.27
84 0.21
85 0.21
86 0.22
87 0.25
88 0.25
89 0.25
90 0.29
91 0.3
92 0.33
93 0.35
94 0.38
95 0.41
96 0.45
97 0.52
98 0.5
99 0.49
100 0.49
101 0.46
102 0.45
103 0.38
104 0.36
105 0.36
106 0.33
107 0.33
108 0.29
109 0.26
110 0.22
111 0.26
112 0.27
113 0.22
114 0.23
115 0.25
116 0.27
117 0.29
118 0.31
119 0.29
120 0.3
121 0.33
122 0.31
123 0.29
124 0.26
125 0.27
126 0.24
127 0.24
128 0.21
129 0.19
130 0.19
131 0.25
132 0.29
133 0.34
134 0.42
135 0.5
136 0.6
137 0.67
138 0.75
139 0.79
140 0.87
141 0.89
142 0.91
143 0.91
144 0.85
145 0.75
146 0.72
147 0.65
148 0.55
149 0.48
150 0.37
151 0.32
152 0.29
153 0.3
154 0.3
155 0.27
156 0.27
157 0.28
158 0.29
159 0.28
160 0.31
161 0.28
162 0.27
163 0.28
164 0.27
165 0.22
166 0.2
167 0.19
168 0.19
169 0.25
170 0.3
171 0.35
172 0.39