Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2NH38

Protein Details
Accession A0A0D2NH38    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-32RCAFKRGFDKFRMKRKRRARTHSRAFNEKRLBasic
NLS Segment(s)
PositionSequence
10-25DKFRMKRKRRARTHSR
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MRCAFKRGFDKFRMKRKRRARTHSRAFNEKRLTGAAHVALDLAAAHTYARVHFHSSAERMYFQPSEAPCSRHRMMKLMME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.85
4 0.87
5 0.87
6 0.88
7 0.88
8 0.88
9 0.92
10 0.91
11 0.87
12 0.87
13 0.81
14 0.79
15 0.73
16 0.62
17 0.53
18 0.44
19 0.38
20 0.28
21 0.26
22 0.17
23 0.12
24 0.11
25 0.1
26 0.08
27 0.07
28 0.06
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.07
37 0.08
38 0.12
39 0.13
40 0.15
41 0.19
42 0.2
43 0.23
44 0.22
45 0.23
46 0.2
47 0.23
48 0.21
49 0.18
50 0.22
51 0.2
52 0.26
53 0.27
54 0.3
55 0.29
56 0.37
57 0.39
58 0.4
59 0.41
60 0.4