Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NEU1

Protein Details
Accession A0A0D2NEU1   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-150TGVPSRTRKGEPKTRRRATASAHydrophilic
NLS Segment(s)
PositionSequence
137-146RKGEPKTRRR
Subcellular Location(s) mito 13, cyto 8, cyto_nucl 7.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR004365  NA-bd_OB_tRNA  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01336  tRNA_anti-codon  
Amino Acid Sequences MKYFWQSVGVRHPDDAQYVALCRCVLQERHVRVPSLEEEVFHDEHQVALSRPPLTRTGNGTESVIAVASKFDGGMESLAGRIHNLCASGSKLKFCDLRGXGTKIQIMAAQQESLIVTHQRFKRGDIVGVTGVPSRTRKGEPKTRRRATASAAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.23
4 0.18
5 0.19
6 0.18
7 0.17
8 0.15
9 0.13
10 0.14
11 0.19
12 0.19
13 0.24
14 0.33
15 0.37
16 0.46
17 0.48
18 0.47
19 0.41
20 0.43
21 0.38
22 0.35
23 0.29
24 0.21
25 0.22
26 0.25
27 0.26
28 0.22
29 0.2
30 0.14
31 0.14
32 0.14
33 0.12
34 0.09
35 0.09
36 0.12
37 0.13
38 0.14
39 0.16
40 0.19
41 0.21
42 0.23
43 0.25
44 0.27
45 0.27
46 0.27
47 0.26
48 0.21
49 0.19
50 0.16
51 0.12
52 0.07
53 0.05
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.05
73 0.06
74 0.09
75 0.15
76 0.15
77 0.16
78 0.17
79 0.19
80 0.21
81 0.21
82 0.27
83 0.23
84 0.28
85 0.29
86 0.31
87 0.29
88 0.29
89 0.28
90 0.2
91 0.2
92 0.15
93 0.15
94 0.13
95 0.13
96 0.11
97 0.11
98 0.11
99 0.09
100 0.1
101 0.09
102 0.09
103 0.17
104 0.2
105 0.26
106 0.27
107 0.29
108 0.36
109 0.36
110 0.39
111 0.33
112 0.34
113 0.28
114 0.28
115 0.27
116 0.21
117 0.19
118 0.18
119 0.19
120 0.18
121 0.21
122 0.27
123 0.34
124 0.42
125 0.52
126 0.6
127 0.69
128 0.78
129 0.82
130 0.84
131 0.82
132 0.78
133 0.74