Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PHZ8

Protein Details
Accession A0A0D2PHZ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-117GRSHRFSLGRRDRGKKQNIKKWRVISGNHydrophilic
NLS Segment(s)
PositionSequence
98-110GRRDRGKKQNIKK
Subcellular Location(s) mito 21, cyto 2.5, cyto_nucl 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MPASRAWLSGVCKHYVDAAPAGAGEPEGDVWVVAQQASKRAAGVRMFERRGVQNRGAPEHAAWGDAQESDERAFERARTNQVQPTPFSAGRSHRFSLGRRDRGKKQNIKKWRVISGNGYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.21
5 0.18
6 0.16
7 0.15
8 0.15
9 0.1
10 0.09
11 0.06
12 0.05
13 0.04
14 0.05
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.07
22 0.07
23 0.11
24 0.13
25 0.13
26 0.12
27 0.14
28 0.18
29 0.17
30 0.21
31 0.23
32 0.28
33 0.29
34 0.3
35 0.31
36 0.32
37 0.36
38 0.37
39 0.34
40 0.3
41 0.31
42 0.32
43 0.31
44 0.27
45 0.21
46 0.19
47 0.16
48 0.13
49 0.11
50 0.08
51 0.08
52 0.07
53 0.08
54 0.05
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.14
63 0.17
64 0.22
65 0.26
66 0.28
67 0.32
68 0.37
69 0.38
70 0.34
71 0.35
72 0.35
73 0.32
74 0.32
75 0.31
76 0.33
77 0.36
78 0.41
79 0.38
80 0.37
81 0.4
82 0.41
83 0.48
84 0.52
85 0.56
86 0.59
87 0.65
88 0.69
89 0.75
90 0.83
91 0.82
92 0.82
93 0.83
94 0.86
95 0.87
96 0.86
97 0.83
98 0.82
99 0.77
100 0.71