Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Q655

Protein Details
Accession A0A0D2Q655   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-107ISTSAKKSKTKLKKAKTPVSSSSHydrophilic
433-459IVTRGAGFRKEKNKKKRGSYRGGEITMHydrophilic
NLS Segment(s)
PositionSequence
90-100KKSKTKLKKAK
439-450GFRKEKNKKKRG
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MDRNLATTYTLIHAFLTKHSHGKAAEAVKKAAKGVVVLKDDIKVEGPQLDEIIEQWKQIPQKKSKQSDSGSGSSSSNSSDSSSSISTSAKKSKTKLKKAKTPVSSSSDSSEYEKPAPKASSPTKKTKSTLKNAKTPSSSSSSSVSSSESSEGEISAPKASEVKKKEAAKSSGSSSSNSSSEDEKSTVKAKALKAPVPSTSSSSSSSDDESSDATTAQTTKVPATKKISSVASSTTQKTASDSSSSDSSDSDSDVETKTTTTKVTITTQKKESAAKKDFSGSSRSDSSSEDESAARNAATKPIKTVKTVKKASATSSSGSSSDSSSDSDAKMVTDKPIPKASSPAKIIADNGQVTKKRRTNEQGNSVVTAYTANAENESASARVKGGNGKPGRQVNERFKRVDASRIAPIQDNGYVAKVGPENDYGKRAHEDLIVTRGAGFRKEKNKKKRGSYRGGEITMESHSFKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.25
4 0.25
5 0.3
6 0.31
7 0.35
8 0.32
9 0.35
10 0.38
11 0.4
12 0.44
13 0.42
14 0.45
15 0.43
16 0.44
17 0.42
18 0.36
19 0.28
20 0.24
21 0.27
22 0.3
23 0.3
24 0.3
25 0.3
26 0.31
27 0.31
28 0.29
29 0.25
30 0.18
31 0.17
32 0.18
33 0.18
34 0.16
35 0.16
36 0.15
37 0.13
38 0.13
39 0.16
40 0.14
41 0.13
42 0.13
43 0.17
44 0.23
45 0.31
46 0.4
47 0.45
48 0.55
49 0.65
50 0.73
51 0.77
52 0.8
53 0.76
54 0.76
55 0.73
56 0.66
57 0.58
58 0.5
59 0.43
60 0.35
61 0.31
62 0.23
63 0.17
64 0.14
65 0.13
66 0.12
67 0.12
68 0.15
69 0.15
70 0.14
71 0.15
72 0.16
73 0.18
74 0.23
75 0.31
76 0.34
77 0.39
78 0.43
79 0.52
80 0.61
81 0.69
82 0.74
83 0.76
84 0.8
85 0.85
86 0.89
87 0.87
88 0.83
89 0.79
90 0.75
91 0.69
92 0.6
93 0.53
94 0.45
95 0.38
96 0.35
97 0.31
98 0.27
99 0.29
100 0.33
101 0.31
102 0.34
103 0.34
104 0.32
105 0.38
106 0.44
107 0.49
108 0.5
109 0.59
110 0.61
111 0.65
112 0.67
113 0.68
114 0.69
115 0.69
116 0.74
117 0.7
118 0.72
119 0.71
120 0.74
121 0.67
122 0.59
123 0.52
124 0.47
125 0.42
126 0.35
127 0.32
128 0.27
129 0.25
130 0.24
131 0.21
132 0.16
133 0.16
134 0.15
135 0.13
136 0.12
137 0.11
138 0.11
139 0.1
140 0.1
141 0.1
142 0.09
143 0.09
144 0.08
145 0.12
146 0.14
147 0.22
148 0.25
149 0.3
150 0.37
151 0.42
152 0.47
153 0.52
154 0.53
155 0.49
156 0.47
157 0.45
158 0.44
159 0.4
160 0.35
161 0.3
162 0.29
163 0.25
164 0.24
165 0.22
166 0.17
167 0.18
168 0.18
169 0.18
170 0.16
171 0.17
172 0.19
173 0.18
174 0.19
175 0.23
176 0.23
177 0.28
178 0.32
179 0.34
180 0.34
181 0.35
182 0.34
183 0.32
184 0.31
185 0.27
186 0.25
187 0.24
188 0.23
189 0.22
190 0.22
191 0.2
192 0.2
193 0.17
194 0.15
195 0.14
196 0.12
197 0.1
198 0.09
199 0.08
200 0.07
201 0.06
202 0.07
203 0.07
204 0.08
205 0.08
206 0.09
207 0.13
208 0.14
209 0.19
210 0.24
211 0.26
212 0.26
213 0.29
214 0.29
215 0.26
216 0.25
217 0.23
218 0.22
219 0.22
220 0.22
221 0.2
222 0.19
223 0.18
224 0.18
225 0.17
226 0.14
227 0.13
228 0.13
229 0.13
230 0.14
231 0.14
232 0.13
233 0.11
234 0.11
235 0.1
236 0.1
237 0.08
238 0.07
239 0.08
240 0.08
241 0.08
242 0.07
243 0.07
244 0.08
245 0.08
246 0.08
247 0.08
248 0.09
249 0.11
250 0.16
251 0.25
252 0.3
253 0.34
254 0.37
255 0.39
256 0.4
257 0.44
258 0.45
259 0.46
260 0.46
261 0.42
262 0.41
263 0.42
264 0.42
265 0.37
266 0.35
267 0.27
268 0.26
269 0.26
270 0.26
271 0.23
272 0.22
273 0.24
274 0.22
275 0.21
276 0.18
277 0.16
278 0.15
279 0.15
280 0.14
281 0.11
282 0.1
283 0.1
284 0.16
285 0.18
286 0.18
287 0.22
288 0.29
289 0.31
290 0.33
291 0.43
292 0.45
293 0.52
294 0.56
295 0.54
296 0.54
297 0.53
298 0.53
299 0.5
300 0.43
301 0.35
302 0.33
303 0.3
304 0.24
305 0.24
306 0.21
307 0.14
308 0.13
309 0.13
310 0.11
311 0.12
312 0.13
313 0.12
314 0.12
315 0.12
316 0.11
317 0.12
318 0.12
319 0.13
320 0.18
321 0.2
322 0.24
323 0.3
324 0.31
325 0.3
326 0.37
327 0.39
328 0.4
329 0.4
330 0.41
331 0.36
332 0.35
333 0.36
334 0.32
335 0.32
336 0.27
337 0.26
338 0.28
339 0.31
340 0.34
341 0.42
342 0.43
343 0.41
344 0.48
345 0.55
346 0.6
347 0.64
348 0.7
349 0.67
350 0.65
351 0.64
352 0.55
353 0.45
354 0.35
355 0.26
356 0.16
357 0.11
358 0.1
359 0.09
360 0.09
361 0.09
362 0.09
363 0.09
364 0.11
365 0.1
366 0.09
367 0.09
368 0.09
369 0.11
370 0.13
371 0.2
372 0.23
373 0.31
374 0.34
375 0.37
376 0.44
377 0.49
378 0.53
379 0.53
380 0.58
381 0.6
382 0.67
383 0.69
384 0.64
385 0.59
386 0.61
387 0.56
388 0.55
389 0.49
390 0.43
391 0.44
392 0.45
393 0.45
394 0.4
395 0.39
396 0.33
397 0.29
398 0.26
399 0.2
400 0.18
401 0.16
402 0.14
403 0.16
404 0.15
405 0.15
406 0.16
407 0.2
408 0.23
409 0.25
410 0.29
411 0.27
412 0.28
413 0.3
414 0.29
415 0.27
416 0.26
417 0.27
418 0.26
419 0.3
420 0.27
421 0.23
422 0.23
423 0.24
424 0.22
425 0.24
426 0.26
427 0.3
428 0.41
429 0.52
430 0.61
431 0.69
432 0.78
433 0.82
434 0.89
435 0.91
436 0.91
437 0.91
438 0.88
439 0.88
440 0.87
441 0.79
442 0.69
443 0.59
444 0.5
445 0.43
446 0.37