Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2P6Z4

Protein Details
Accession A0A0D2P6Z4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-121PLDLRPKRTRAIRRRLTKHESSLKTLKQTKKDQNFPIRKYAVHydrophilic
NLS Segment(s)
PositionSequence
84-98RPKRTRAIRRRLTKH
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKAYELQSKSKNDLSKQLLELKNELLTLRVQKIAGGSASKLTKISTVRKSIARVLTVMNQKARQNLREYYKDKKYIPLDLRPKRTRAIRRRLTKHESSLKTLKQTKKDQNFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.54
4 0.5
5 0.49
6 0.49
7 0.53
8 0.51
9 0.47
10 0.46
11 0.38
12 0.33
13 0.29
14 0.25
15 0.17
16 0.16
17 0.17
18 0.17
19 0.17
20 0.16
21 0.16
22 0.16
23 0.16
24 0.15
25 0.12
26 0.11
27 0.13
28 0.14
29 0.14
30 0.13
31 0.12
32 0.15
33 0.18
34 0.25
35 0.27
36 0.31
37 0.34
38 0.36
39 0.38
40 0.39
41 0.38
42 0.31
43 0.26
44 0.23
45 0.26
46 0.27
47 0.27
48 0.24
49 0.24
50 0.24
51 0.3
52 0.31
53 0.28
54 0.28
55 0.31
56 0.35
57 0.4
58 0.42
59 0.44
60 0.49
61 0.52
62 0.49
63 0.51
64 0.48
65 0.48
66 0.5
67 0.52
68 0.55
69 0.58
70 0.67
71 0.63
72 0.63
73 0.6
74 0.64
75 0.66
76 0.66
77 0.69
78 0.69
79 0.75
80 0.81
81 0.85
82 0.83
83 0.8
84 0.78
85 0.78
86 0.72
87 0.69
88 0.68
89 0.63
90 0.64
91 0.66
92 0.64
93 0.63
94 0.69
95 0.73
96 0.75
97 0.8
98 0.81
99 0.83
100 0.86
101 0.81
102 0.81
103 0.75