Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NA62

Protein Details
Accession A0A0D2NA62    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21ALPLVNRTPRRPRDRRIVSATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences ALPLVNRTPRRPRDRRIVSATGGVYAAHIVHNHTAGIHTPNDCSLGQEKLGEFCEGGGEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.79
4 0.73
5 0.64
6 0.6
7 0.52
8 0.42
9 0.32
10 0.24
11 0.16
12 0.11
13 0.1
14 0.05
15 0.05
16 0.06
17 0.06
18 0.07
19 0.06
20 0.06
21 0.06
22 0.07
23 0.09
24 0.1
25 0.1
26 0.11
27 0.11
28 0.14
29 0.13
30 0.15
31 0.15
32 0.15
33 0.16
34 0.17
35 0.17
36 0.17
37 0.19
38 0.17
39 0.15
40 0.13