Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2N9B2

Protein Details
Accession A0A0D2N9B2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-73RMAPARPTPTPRPRRNPPRISHQETSHydrophilic
193-212KEDQLRRSRHREPRGPWSMLBasic
NLS Segment(s)
PositionSequence
45-66RPARMAPARPTPTPRPRRNPPR
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MKRPAVSPPGSPSPVPSKTKGNDRVTSPIPIPSRAPITRPAAQIRPARMAPARPTPTPRPRRNPPRISHQETSSRASKKHAVKISVSDTDAPLADKAASDVASESEASDEDPSPQNTDDCDYVEPVDSSLRDAPANKTSIDSDIEMKPNRASTTSTKGKKKAATAPTSTSAPTTTDPPVLLTEKQSNHQATMKEDQLRRSRHREPRGPWSMLQLHPYFSEAPLWSVPLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.46
4 0.47
5 0.5
6 0.6
7 0.65
8 0.64
9 0.62
10 0.61
11 0.64
12 0.58
13 0.57
14 0.48
15 0.45
16 0.39
17 0.36
18 0.34
19 0.31
20 0.35
21 0.32
22 0.34
23 0.33
24 0.38
25 0.41
26 0.44
27 0.46
28 0.42
29 0.48
30 0.51
31 0.48
32 0.47
33 0.42
34 0.41
35 0.39
36 0.39
37 0.37
38 0.42
39 0.43
40 0.4
41 0.46
42 0.52
43 0.6
44 0.66
45 0.7
46 0.69
47 0.76
48 0.84
49 0.88
50 0.88
51 0.82
52 0.83
53 0.83
54 0.82
55 0.75
56 0.68
57 0.66
58 0.6
59 0.59
60 0.55
61 0.48
62 0.41
63 0.41
64 0.44
65 0.42
66 0.48
67 0.48
68 0.44
69 0.43
70 0.47
71 0.47
72 0.42
73 0.36
74 0.28
75 0.23
76 0.2
77 0.19
78 0.15
79 0.1
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.09
99 0.1
100 0.11
101 0.11
102 0.11
103 0.11
104 0.12
105 0.11
106 0.1
107 0.1
108 0.09
109 0.09
110 0.1
111 0.09
112 0.08
113 0.08
114 0.07
115 0.08
116 0.09
117 0.09
118 0.09
119 0.11
120 0.13
121 0.16
122 0.18
123 0.16
124 0.16
125 0.16
126 0.17
127 0.17
128 0.15
129 0.14
130 0.16
131 0.2
132 0.2
133 0.2
134 0.2
135 0.2
136 0.2
137 0.18
138 0.19
139 0.19
140 0.27
141 0.36
142 0.42
143 0.47
144 0.51
145 0.56
146 0.56
147 0.57
148 0.57
149 0.57
150 0.56
151 0.53
152 0.53
153 0.5
154 0.48
155 0.42
156 0.34
157 0.26
158 0.21
159 0.19
160 0.17
161 0.16
162 0.16
163 0.16
164 0.17
165 0.19
166 0.19
167 0.19
168 0.2
169 0.25
170 0.26
171 0.29
172 0.34
173 0.33
174 0.33
175 0.36
176 0.34
177 0.33
178 0.37
179 0.39
180 0.4
181 0.41
182 0.46
183 0.5
184 0.57
185 0.59
186 0.62
187 0.66
188 0.69
189 0.77
190 0.78
191 0.77
192 0.79
193 0.81
194 0.76
195 0.67
196 0.65
197 0.61
198 0.54
199 0.54
200 0.44
201 0.38
202 0.34
203 0.36
204 0.28
205 0.22
206 0.25
207 0.19
208 0.21
209 0.2
210 0.22