Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G5H0

Protein Details
Accession A0A0D2G5H0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
101-127KKDASRVTEKQKKRQTHFPARKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
88-121RPKLTRAIRRRLSKKDASRVTEKQKKRQTHFPAR
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MSSSSARVKPGQLWGKSKDDLKKQLDELKTELGQLRVQKIAGGASSKLTRIHDLRKSVARTLTVINANQRHQLRLFYAKKKYLPLDLRPKLTRAIRRRLSKKDASRVTEKQKKRQTHFPARKYAVKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.54
4 0.57
5 0.55
6 0.55
7 0.58
8 0.57
9 0.57
10 0.55
11 0.59
12 0.56
13 0.51
14 0.45
15 0.4
16 0.36
17 0.32
18 0.3
19 0.24
20 0.24
21 0.23
22 0.23
23 0.19
24 0.19
25 0.17
26 0.16
27 0.15
28 0.13
29 0.12
30 0.1
31 0.11
32 0.12
33 0.13
34 0.14
35 0.15
36 0.17
37 0.19
38 0.26
39 0.28
40 0.31
41 0.34
42 0.37
43 0.39
44 0.37
45 0.36
46 0.29
47 0.25
48 0.23
49 0.23
50 0.19
51 0.18
52 0.2
53 0.21
54 0.21
55 0.26
56 0.25
57 0.23
58 0.22
59 0.22
60 0.21
61 0.28
62 0.33
63 0.35
64 0.4
65 0.43
66 0.45
67 0.48
68 0.47
69 0.46
70 0.46
71 0.47
72 0.52
73 0.52
74 0.57
75 0.54
76 0.53
77 0.51
78 0.51
79 0.52
80 0.49
81 0.55
82 0.57
83 0.66
84 0.73
85 0.76
86 0.78
87 0.78
88 0.79
89 0.79
90 0.79
91 0.74
92 0.75
93 0.74
94 0.76
95 0.76
96 0.75
97 0.75
98 0.76
99 0.8
100 0.78
101 0.81
102 0.81
103 0.82
104 0.86
105 0.83
106 0.85
107 0.81
108 0.82