FuNGI

A0A0D2E0V7

Protein Details

Accession

A0A0D2E0V7

Localization Confidence

Low

Confidence Score

7.5

NoLS Segment(s)

Position	Sequence	Protein Nature
63-84	QQDVLRGVKRKRKNTADTPGEH	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 12.5, cyto_nucl 11.5, nucl 9.5, pero 5

Family & Domain DBs

InterPro	View protein in InterPro IPR013632 DNA_recomb/repair_Rad51_C IPR027417 P-loop_NTPase IPR020588 RecA_ATP-bd IPR047348 XRCC3-like_C
Gene Ontology	GO:0005524 F:ATP binding GO:0140664 F:ATP-dependent DNA damage sensor activity GO:0003677 F:DNA binding GO:0006310 P:DNA recombination GO:0006281 P:DNA repair GO:0061982 P:meiosis I cell cycle process
Pfam	View protein in Pfam PF08423 Rad51
PROSITE	View protein in PROSITE PS50162 RECA_2
CDD	cd19491 XRCC3

Amino Acid Sequences

MDLLDVLPDLDLKPHTHLLHSLDKNGVSVSQLIALAPTEIARICPLPPRDVDRLARDVVKALQQDVLRGVKRKRKNTADTPGEHQTKAKETKTNEQAGVKTLDLILDKALNGGIQPGHITEVVGESRTGKTTFALGLLLSVQLAPPIGLGKAGIFVTSEGPLNTKRLNQMLLSFADLPPKQRPSLDHVHAITVSDLEAQEHILRYQLPVAIQRYNVGLVVLDSVTANFRAEYSTRTPAQLADRAVELTNLGNILRHIAVEHHVAIVVTNQVSDRFDDSKSLFRSGSPATPSSPATSLQNLPAAVAERRQETQSLDHQQRFFTGWGDTKGNTEHEQLKTPALGLAWANQISARIVLKMESERQEYIGGSIWKDKNPTRTFGVVFAPWAPTTKPPIRYEIAPQGIVSITNPERPTEAPGAIDEEHAELLDEALWATDEDDEFP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.24
2	0.25
3	0.26
4	0.3
5	0.33
6	0.41
7	0.42
8	0.41
9	0.38
10	0.37
11	0.36
12	0.32
13	0.27
14	0.18
15	0.17
16	0.14
17	0.12
18	0.12
19	0.11
20	0.11
21	0.11
22	0.1
23	0.09
24	0.08
25	0.07
26	0.07
27	0.08
28	0.1
29	0.11
30	0.12
31	0.2
32	0.22
33	0.25
34	0.29
35	0.35
36	0.39
37	0.45
38	0.49
39	0.47
40	0.48
41	0.47
42	0.45
43	0.39
44	0.36
45	0.31
46	0.31
47	0.27
48	0.24
49	0.25
50	0.23
51	0.24
52	0.26
53	0.3
54	0.28
55	0.34
56	0.41
57	0.46
58	0.55
59	0.62
60	0.68
61	0.72
62	0.77
63	0.81
64	0.83
65	0.82
66	0.77
67	0.74
68	0.73
69	0.67
70	0.58
71	0.5
72	0.42
73	0.42
74	0.45
75	0.44
76	0.4
77	0.42
78	0.51
79	0.57
80	0.6
81	0.55
82	0.51
83	0.48
84	0.45
85	0.43
86	0.33
87	0.26
88	0.2
89	0.18
90	0.15
91	0.14
92	0.11
93	0.09
94	0.09
95	0.09
96	0.09
97	0.07
98	0.06
99	0.08
100	0.07
101	0.06
102	0.07
103	0.07
104	0.08
105	0.08
106	0.08
107	0.07
108	0.09
109	0.09
110	0.1
111	0.09
112	0.1
113	0.11
114	0.13
115	0.13
116	0.11
117	0.11
118	0.12
119	0.12
120	0.11
121	0.1
122	0.08
123	0.08
124	0.08
125	0.07
126	0.06
127	0.05
128	0.04
129	0.04
130	0.04
131	0.04
132	0.03
133	0.04
134	0.04
135	0.04
136	0.04
137	0.04
138	0.06
139	0.06
140	0.06
141	0.05
142	0.06
143	0.07
144	0.08
145	0.09
146	0.07
147	0.09
148	0.1
149	0.12
150	0.13
151	0.15
152	0.16
153	0.18
154	0.19
155	0.18
156	0.19
157	0.19
158	0.18
159	0.18
160	0.17
161	0.15
162	0.19
163	0.19
164	0.2
165	0.22
166	0.24
167	0.23
168	0.23
169	0.25
170	0.26
171	0.34
172	0.34
173	0.34
174	0.32
175	0.32
176	0.31
177	0.29
178	0.22
179	0.14
180	0.11
181	0.07
182	0.06
183	0.05
184	0.05
185	0.06
186	0.06
187	0.07
188	0.06
189	0.06
190	0.07
191	0.07
192	0.08
193	0.08
194	0.08
195	0.11
196	0.14
197	0.15
198	0.14
199	0.15
200	0.14
201	0.13
202	0.13
203	0.09
204	0.06
205	0.05
206	0.06
207	0.05
208	0.04
209	0.04
210	0.04
211	0.05
212	0.05
213	0.05
214	0.04
215	0.04
216	0.06
217	0.06
218	0.1
219	0.13
220	0.17
221	0.18
222	0.18
223	0.19
224	0.2
225	0.22
226	0.23
227	0.2
228	0.16
229	0.16
230	0.16
231	0.16
232	0.13
233	0.11
234	0.07
235	0.06
236	0.06
237	0.05
238	0.05
239	0.05
240	0.06
241	0.06
242	0.06
243	0.06
244	0.06
245	0.08
246	0.09
247	0.1
248	0.08
249	0.08
250	0.08
251	0.08
252	0.08
253	0.07
254	0.05
255	0.05
256	0.06
257	0.06
258	0.07
259	0.08
260	0.11
261	0.11
262	0.12
263	0.15
264	0.16
265	0.23
266	0.24
267	0.26
268	0.22
269	0.21
270	0.24
271	0.23
272	0.26
273	0.22
274	0.21
275	0.2
276	0.22
277	0.23
278	0.21
279	0.21
280	0.17
281	0.17
282	0.19
283	0.18
284	0.18
285	0.19
286	0.17
287	0.16
288	0.16
289	0.16
290	0.13
291	0.15
292	0.15
293	0.15
294	0.16
295	0.17
296	0.18
297	0.18
298	0.22
299	0.27
300	0.34
301	0.38
302	0.41
303	0.42
304	0.4
305	0.4
306	0.38
307	0.3
308	0.23
309	0.2
310	0.18
311	0.21
312	0.23
313	0.22
314	0.21
315	0.22
316	0.24
317	0.23
318	0.24
319	0.27
320	0.27
321	0.31
322	0.3
323	0.3
324	0.27
325	0.25
326	0.22
327	0.16
328	0.15
329	0.11
330	0.13
331	0.14
332	0.14
333	0.14
334	0.13
335	0.13
336	0.12
337	0.14
338	0.12
339	0.09
340	0.1
341	0.1
342	0.13
343	0.16
344	0.21
345	0.23
346	0.26
347	0.26
348	0.27
349	0.28
350	0.25
351	0.23
352	0.23
353	0.2
354	0.18
355	0.26
356	0.27
357	0.28
358	0.34
359	0.37
360	0.42
361	0.44
362	0.47
363	0.44
364	0.46
365	0.45
366	0.42
367	0.42
368	0.32
369	0.3
370	0.27
371	0.25
372	0.2
373	0.21
374	0.19
375	0.19
376	0.27
377	0.32
378	0.39
379	0.39
380	0.45
381	0.47
382	0.48
383	0.52
384	0.53
385	0.5
386	0.43
387	0.4
388	0.36
389	0.32
390	0.3
391	0.22
392	0.2
393	0.17
394	0.23
395	0.24
396	0.23
397	0.26
398	0.26
399	0.32
400	0.29
401	0.28
402	0.23
403	0.23
404	0.27
405	0.25
406	0.24
407	0.19
408	0.16
409	0.15
410	0.13
411	0.13
412	0.09
413	0.08
414	0.08
415	0.07
416	0.06
417	0.06
418	0.07
419	0.06
420	0.07
421	0.08

A0A0D2E0V7

3D AlphaFold-predicted Structure Viewer