Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9ECX5

Protein Details
Accession E9ECX5    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
186-212RDKRLGTNYREKKDKRREIPIPEIHKGBasic
NLS Segment(s)
PositionSequence
197-202KKDKRR
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010686  OBAP-like  
KEGG maw:MAC_07723  -  
Pfam View protein in Pfam  
PF06884  DUF1264  
Amino Acid Sequences MESTPLTNEACGHPTSKKETVLLGAASITQDFKPLKNICAHLNAFHAYADDPSRSVEADHFCSQINSDVRQCLLYDSPDSNAKLIGIEYMITPRLFASLPPDERCLWHSHVYEVKSGMLVMPNRLVPQTAWDTAENKEMEEIITLYGKTYHLWQTDRGDKLPLGEPKLMTSYTCDGQLDFAKVEERDKRLGTNYREKKDKRREIPIPEIHKGKFTSVKLANSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.35
4 0.35
5 0.33
6 0.34
7 0.34
8 0.34
9 0.29
10 0.22
11 0.17
12 0.15
13 0.14
14 0.13
15 0.11
16 0.08
17 0.13
18 0.14
19 0.15
20 0.23
21 0.25
22 0.28
23 0.32
24 0.35
25 0.33
26 0.4
27 0.4
28 0.33
29 0.34
30 0.32
31 0.26
32 0.24
33 0.21
34 0.14
35 0.14
36 0.15
37 0.12
38 0.11
39 0.12
40 0.12
41 0.12
42 0.12
43 0.14
44 0.15
45 0.21
46 0.22
47 0.22
48 0.21
49 0.21
50 0.21
51 0.24
52 0.23
53 0.2
54 0.2
55 0.2
56 0.2
57 0.21
58 0.2
59 0.16
60 0.14
61 0.13
62 0.14
63 0.14
64 0.15
65 0.18
66 0.19
67 0.17
68 0.15
69 0.14
70 0.12
71 0.11
72 0.09
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.06
81 0.08
82 0.07
83 0.07
84 0.12
85 0.16
86 0.19
87 0.2
88 0.23
89 0.22
90 0.23
91 0.25
92 0.23
93 0.21
94 0.24
95 0.23
96 0.23
97 0.26
98 0.26
99 0.26
100 0.22
101 0.19
102 0.13
103 0.13
104 0.1
105 0.1
106 0.09
107 0.09
108 0.09
109 0.1
110 0.1
111 0.1
112 0.11
113 0.07
114 0.11
115 0.13
116 0.13
117 0.15
118 0.15
119 0.17
120 0.18
121 0.23
122 0.19
123 0.16
124 0.15
125 0.13
126 0.12
127 0.11
128 0.1
129 0.06
130 0.07
131 0.06
132 0.06
133 0.07
134 0.08
135 0.07
136 0.1
137 0.14
138 0.17
139 0.19
140 0.23
141 0.28
142 0.34
143 0.37
144 0.34
145 0.32
146 0.29
147 0.3
148 0.33
149 0.31
150 0.28
151 0.28
152 0.27
153 0.26
154 0.28
155 0.26
156 0.19
157 0.19
158 0.19
159 0.18
160 0.19
161 0.17
162 0.15
163 0.18
164 0.2
165 0.18
166 0.15
167 0.14
168 0.16
169 0.16
170 0.22
171 0.25
172 0.26
173 0.29
174 0.3
175 0.32
176 0.36
177 0.44
178 0.47
179 0.52
180 0.58
181 0.61
182 0.7
183 0.73
184 0.77
185 0.79
186 0.82
187 0.8
188 0.81
189 0.82
190 0.81
191 0.86
192 0.84
193 0.81
194 0.77
195 0.74
196 0.64
197 0.61
198 0.53
199 0.49
200 0.47
201 0.41
202 0.44
203 0.44