Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2FU49

Protein Details
Accession A0A0D2FU49    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-86ELLRNSKDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
26-39PKPRISRRKGALSK
66-90RNSKDKRARKLAKKRLGTFGRAKRK
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKERTEKSGFIVGLNKGHKVTPLTPKPRISRRKGALSKRTAFVREIVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRAKRKVDELTRVIAEARRTGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.31
4 0.25
5 0.25
6 0.26
7 0.25
8 0.29
9 0.33
10 0.41
11 0.47
12 0.53
13 0.59
14 0.64
15 0.7
16 0.74
17 0.71
18 0.72
19 0.71
20 0.75
21 0.77
22 0.79
23 0.78
24 0.77
25 0.72
26 0.66
27 0.62
28 0.53
29 0.45
30 0.39
31 0.36
32 0.28
33 0.27
34 0.24
35 0.21
36 0.19
37 0.18
38 0.14
39 0.08
40 0.07
41 0.05
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.14
50 0.2
51 0.26
52 0.29
53 0.36
54 0.36
55 0.42
56 0.5
57 0.52
58 0.53
59 0.58
60 0.64
61 0.69
62 0.79
63 0.83
64 0.84
65 0.86
66 0.82
67 0.81
68 0.76
69 0.72
70 0.7
71 0.7
72 0.71
73 0.68
74 0.66
75 0.59
76 0.61
77 0.61
78 0.58
79 0.57
80 0.49
81 0.48
82 0.47
83 0.44
84 0.39
85 0.36
86 0.31
87 0.25