Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FK23

Protein Details
Accession A0A0D2FK23    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
160-213LARAFNKQKEKAKKEKERKEREKKERERREREQKEEERKERERERERQRQQSSGBasic
NLS Segment(s)
PositionSequence
160-206LARAFNKQKEKAKKEKERKEREKKERERREREQKEEERKERERERER
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
Amino Acid Sequences MGPPFTNGGHYVLQNASSGAFLDFNHTRSPKGNVWSHNPDTAGEVFAAFRKKSTPLTVSFQDIGGPAVLSHGADGSPINFVVDPDKLAGQWTVVPDETGLYKGFVRLKNVKTGAFLDGVGGAGKRAVGSKRKGGASQLWHLIQVPTDLTEPQLKTKKQELARAFNKQKEKAKKEKERKEREKKERERREREQKEEERKERERERERQRQQSSGPAQWARLGYIPTDQYNRIVQGMGYPGVRPQQYGGYYGGGRCGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.11
5 0.12
6 0.09
7 0.09
8 0.08
9 0.15
10 0.16
11 0.18
12 0.25
13 0.25
14 0.26
15 0.28
16 0.35
17 0.33
18 0.39
19 0.44
20 0.43
21 0.51
22 0.57
23 0.58
24 0.54
25 0.49
26 0.42
27 0.39
28 0.34
29 0.26
30 0.17
31 0.14
32 0.12
33 0.14
34 0.18
35 0.15
36 0.14
37 0.16
38 0.19
39 0.22
40 0.28
41 0.29
42 0.29
43 0.36
44 0.37
45 0.39
46 0.37
47 0.33
48 0.28
49 0.24
50 0.2
51 0.13
52 0.11
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.08
69 0.08
70 0.08
71 0.08
72 0.09
73 0.08
74 0.09
75 0.09
76 0.07
77 0.09
78 0.09
79 0.1
80 0.09
81 0.09
82 0.08
83 0.09
84 0.09
85 0.08
86 0.08
87 0.07
88 0.07
89 0.1
90 0.16
91 0.17
92 0.22
93 0.28
94 0.29
95 0.36
96 0.37
97 0.35
98 0.31
99 0.31
100 0.27
101 0.2
102 0.19
103 0.11
104 0.1
105 0.09
106 0.08
107 0.06
108 0.04
109 0.03
110 0.03
111 0.03
112 0.05
113 0.08
114 0.14
115 0.17
116 0.22
117 0.26
118 0.27
119 0.28
120 0.28
121 0.3
122 0.29
123 0.3
124 0.28
125 0.24
126 0.23
127 0.23
128 0.21
129 0.16
130 0.12
131 0.09
132 0.07
133 0.07
134 0.07
135 0.08
136 0.12
137 0.12
138 0.18
139 0.25
140 0.25
141 0.28
142 0.34
143 0.4
144 0.4
145 0.48
146 0.47
147 0.5
148 0.56
149 0.62
150 0.61
151 0.6
152 0.63
153 0.61
154 0.64
155 0.65
156 0.67
157 0.68
158 0.74
159 0.79
160 0.83
161 0.87
162 0.89
163 0.89
164 0.92
165 0.93
166 0.93
167 0.93
168 0.94
169 0.94
170 0.94
171 0.94
172 0.94
173 0.92
174 0.92
175 0.92
176 0.9
177 0.87
178 0.87
179 0.85
180 0.85
181 0.86
182 0.83
183 0.8
184 0.77
185 0.78
186 0.76
187 0.77
188 0.75
189 0.74
190 0.78
191 0.8
192 0.83
193 0.85
194 0.81
195 0.77
196 0.7
197 0.71
198 0.67
199 0.6
200 0.59
201 0.5
202 0.46
203 0.43
204 0.41
205 0.32
206 0.29
207 0.25
208 0.18
209 0.21
210 0.23
211 0.23
212 0.26
213 0.25
214 0.26
215 0.28
216 0.28
217 0.24
218 0.22
219 0.18
220 0.18
221 0.21
222 0.2
223 0.17
224 0.16
225 0.18
226 0.23
227 0.23
228 0.21
229 0.2
230 0.24
231 0.25
232 0.28
233 0.27
234 0.25
235 0.26
236 0.26