Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FJG6

Protein Details
Accession A0A0D2FJG6   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-88LTDKERAAREKVKRRRKKHRAYKQHNLKDMQQBasic
NLS Segment(s)
PositionSequence
60-77KERAAREKVKRRRKKHRA
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MEVSRSLSRATRSFCRLTTPSFLVPFLTRTPAPCMSIATRSFSSGPGLSAPGGPRQLTDKERAAREKVKRRRKKHRAYKQHNLKDMQQFTLCEAMRYIKAFELGQDPDTPKYDIHVKLRTKKDGPIVRNNVRLPYPVKTDIKIVVVCPPDSNAAKGARAAGAYLVGEEEVFERIKTGKIDFDRVIAVPESLQKMNKEGIPRILGPRGLMPNVKMGSVVTNPGPAVRNMMGGSTYRERQGVVRMAVGRLSFTPEMLRDNVKAYVTAVKKDAAALSDQIAKEVYEVVLSSTNSPGFSLNGDFYKPAPGNATPQQLAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.48
4 0.47
5 0.48
6 0.46
7 0.44
8 0.41
9 0.41
10 0.35
11 0.33
12 0.32
13 0.27
14 0.27
15 0.23
16 0.23
17 0.29
18 0.3
19 0.31
20 0.28
21 0.3
22 0.28
23 0.34
24 0.34
25 0.33
26 0.3
27 0.31
28 0.31
29 0.27
30 0.28
31 0.21
32 0.21
33 0.16
34 0.17
35 0.15
36 0.17
37 0.17
38 0.18
39 0.2
40 0.19
41 0.18
42 0.22
43 0.27
44 0.28
45 0.33
46 0.36
47 0.39
48 0.46
49 0.5
50 0.52
51 0.55
52 0.61
53 0.66
54 0.69
55 0.75
56 0.79
57 0.84
58 0.89
59 0.92
60 0.93
61 0.93
62 0.94
63 0.94
64 0.94
65 0.95
66 0.94
67 0.92
68 0.88
69 0.8
70 0.76
71 0.74
72 0.66
73 0.58
74 0.49
75 0.4
76 0.34
77 0.38
78 0.3
79 0.21
80 0.2
81 0.19
82 0.18
83 0.19
84 0.19
85 0.12
86 0.14
87 0.14
88 0.14
89 0.16
90 0.16
91 0.16
92 0.18
93 0.18
94 0.18
95 0.21
96 0.2
97 0.16
98 0.17
99 0.22
100 0.24
101 0.28
102 0.34
103 0.39
104 0.47
105 0.53
106 0.57
107 0.53
108 0.52
109 0.56
110 0.55
111 0.54
112 0.56
113 0.58
114 0.57
115 0.61
116 0.58
117 0.51
118 0.44
119 0.41
120 0.33
121 0.28
122 0.28
123 0.28
124 0.28
125 0.27
126 0.28
127 0.27
128 0.27
129 0.24
130 0.19
131 0.18
132 0.18
133 0.18
134 0.16
135 0.15
136 0.16
137 0.16
138 0.16
139 0.14
140 0.13
141 0.13
142 0.13
143 0.13
144 0.1
145 0.1
146 0.09
147 0.06
148 0.05
149 0.05
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.04
156 0.05
157 0.05
158 0.05
159 0.06
160 0.06
161 0.08
162 0.09
163 0.1
164 0.14
165 0.15
166 0.2
167 0.19
168 0.2
169 0.19
170 0.18
171 0.19
172 0.14
173 0.13
174 0.09
175 0.11
176 0.13
177 0.12
178 0.14
179 0.13
180 0.15
181 0.17
182 0.19
183 0.2
184 0.19
185 0.21
186 0.22
187 0.23
188 0.25
189 0.25
190 0.23
191 0.2
192 0.23
193 0.21
194 0.2
195 0.19
196 0.17
197 0.21
198 0.21
199 0.2
200 0.16
201 0.14
202 0.15
203 0.15
204 0.16
205 0.1
206 0.11
207 0.11
208 0.13
209 0.14
210 0.11
211 0.15
212 0.13
213 0.15
214 0.14
215 0.14
216 0.13
217 0.13
218 0.18
219 0.17
220 0.18
221 0.18
222 0.18
223 0.18
224 0.19
225 0.25
226 0.26
227 0.23
228 0.26
229 0.26
230 0.26
231 0.27
232 0.25
233 0.2
234 0.15
235 0.19
236 0.15
237 0.14
238 0.16
239 0.15
240 0.18
241 0.19
242 0.22
243 0.17
244 0.2
245 0.22
246 0.2
247 0.2
248 0.18
249 0.24
250 0.23
251 0.25
252 0.24
253 0.22
254 0.22
255 0.23
256 0.23
257 0.16
258 0.16
259 0.14
260 0.15
261 0.2
262 0.19
263 0.18
264 0.18
265 0.16
266 0.15
267 0.15
268 0.13
269 0.08
270 0.08
271 0.09
272 0.12
273 0.13
274 0.14
275 0.16
276 0.17
277 0.16
278 0.17
279 0.16
280 0.13
281 0.15
282 0.16
283 0.16
284 0.17
285 0.18
286 0.18
287 0.18
288 0.26
289 0.24
290 0.23
291 0.25
292 0.25
293 0.31
294 0.36
295 0.43
296 0.35