Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FDJ4

Protein Details
Accession A0A0D2FDJ4   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
163-184YTSKKISSMKSKAEKKHPEAYAHydrophilic
NLS Segment(s)
PositionSequence
172-189KSKAEKKHPEAYAKASRS
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MATTTYSRHPVSYNSHQKALPVTLPPSGKGPIYTQPISRVADAPEFSDSSTSYSSSGRSGGSFSVKSGSSYAGSHSGTDYDSYYSRSGIDVVEELSERMNSAFDPLRMDKSLVKQAQTSGELNAKQRELQELQAMAQRRLGRARVNFAEGVEAAKEARRDIEYTSKKISSMKSKAEKKHPEAYAKASRSRHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.52
4 0.52
5 0.5
6 0.46
7 0.38
8 0.31
9 0.29
10 0.3
11 0.3
12 0.3
13 0.29
14 0.27
15 0.24
16 0.21
17 0.23
18 0.24
19 0.3
20 0.31
21 0.3
22 0.33
23 0.37
24 0.37
25 0.35
26 0.3
27 0.25
28 0.27
29 0.26
30 0.22
31 0.2
32 0.18
33 0.17
34 0.16
35 0.14
36 0.13
37 0.13
38 0.12
39 0.11
40 0.12
41 0.12
42 0.12
43 0.13
44 0.11
45 0.1
46 0.11
47 0.11
48 0.14
49 0.14
50 0.13
51 0.15
52 0.14
53 0.15
54 0.14
55 0.14
56 0.11
57 0.11
58 0.13
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.11
66 0.1
67 0.08
68 0.09
69 0.11
70 0.11
71 0.11
72 0.11
73 0.1
74 0.1
75 0.08
76 0.08
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.07
89 0.08
90 0.08
91 0.12
92 0.13
93 0.15
94 0.16
95 0.17
96 0.17
97 0.19
98 0.27
99 0.25
100 0.25
101 0.23
102 0.24
103 0.26
104 0.26
105 0.23
106 0.17
107 0.19
108 0.2
109 0.22
110 0.24
111 0.21
112 0.2
113 0.2
114 0.23
115 0.2
116 0.2
117 0.21
118 0.19
119 0.19
120 0.21
121 0.23
122 0.18
123 0.21
124 0.2
125 0.19
126 0.22
127 0.24
128 0.27
129 0.28
130 0.35
131 0.33
132 0.35
133 0.34
134 0.31
135 0.3
136 0.23
137 0.21
138 0.14
139 0.12
140 0.09
141 0.11
142 0.11
143 0.1
144 0.12
145 0.13
146 0.14
147 0.17
148 0.28
149 0.32
150 0.36
151 0.41
152 0.39
153 0.39
154 0.42
155 0.45
156 0.45
157 0.47
158 0.52
159 0.57
160 0.65
161 0.72
162 0.79
163 0.82
164 0.78
165 0.8
166 0.77
167 0.75
168 0.7
169 0.7
170 0.7
171 0.64
172 0.66