Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EAW9

Protein Details
Accession A0A0D2EAW9   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-43QEYNRRRAAWKESEKKRKQEEKSLRMQAKHydrophilic
NLS Segment(s)
PositionSequence
19-45RRRAAWKESEKKRKQEEKSLRMQAKAA
59-77GRKTKNKSDPFKWIRSSRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPVSGYSVQHDIEVQEYNRRRAAWKESEKKRKQEEKSLRMQAKAAREAALQQVKDLGIGRKTKNKSDPFKWIRSSRKEQPEKTSEPTKGKRLEDDSDGDSDEITLTDALAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.23
3 0.27
4 0.31
5 0.33
6 0.33
7 0.34
8 0.36
9 0.43
10 0.45
11 0.51
12 0.58
13 0.66
14 0.76
15 0.81
16 0.84
17 0.86
18 0.85
19 0.8
20 0.81
21 0.81
22 0.77
23 0.79
24 0.8
25 0.72
26 0.63
27 0.6
28 0.53
29 0.47
30 0.43
31 0.34
32 0.25
33 0.22
34 0.23
35 0.26
36 0.26
37 0.2
38 0.16
39 0.17
40 0.16
41 0.16
42 0.16
43 0.12
44 0.12
45 0.16
46 0.18
47 0.26
48 0.28
49 0.33
50 0.41
51 0.48
52 0.51
53 0.52
54 0.61
55 0.59
56 0.64
57 0.65
58 0.64
59 0.65
60 0.66
61 0.69
62 0.68
63 0.72
64 0.74
65 0.72
66 0.73
67 0.72
68 0.69
69 0.67
70 0.65
71 0.6
72 0.6
73 0.61
74 0.61
75 0.6
76 0.57
77 0.58
78 0.56
79 0.53
80 0.48
81 0.47
82 0.41
83 0.35
84 0.34
85 0.28
86 0.22
87 0.18
88 0.14
89 0.1
90 0.09
91 0.07