Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E0Z2

Protein Details
Accession E9E0Z2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
113-133AEEKKAHDKARDKKRLQKLATBasic
NLS Segment(s)
PositionSequence
115-127EKKAHDKARDKKR
Subcellular Location(s) cyto 19.5, cyto_nucl 14, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
KEGG maw:MAC_03540  -  
Amino Acid Sequences MENLTISDAPPPGARGHAQGPPQLPPQMFTTAAQLLDLTDTNLVLQSTTERIFALKPGTDPSAPEGYYADVVHGIFLIRGENVLLLGEIDLDKDDDPPPNFEPAELELVKKLAEEKKAHDKARDKKRLQKLATMGFEGENLGEAVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.21
4 0.25
5 0.27
6 0.3
7 0.31
8 0.32
9 0.35
10 0.35
11 0.31
12 0.28
13 0.29
14 0.28
15 0.27
16 0.23
17 0.23
18 0.21
19 0.2
20 0.18
21 0.15
22 0.12
23 0.12
24 0.11
25 0.08
26 0.06
27 0.06
28 0.06
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.08
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.11
43 0.11
44 0.13
45 0.15
46 0.15
47 0.15
48 0.17
49 0.18
50 0.17
51 0.16
52 0.14
53 0.12
54 0.13
55 0.13
56 0.09
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.05
80 0.06
81 0.07
82 0.12
83 0.13
84 0.17
85 0.18
86 0.21
87 0.2
88 0.19
89 0.2
90 0.18
91 0.22
92 0.19
93 0.18
94 0.15
95 0.16
96 0.16
97 0.14
98 0.17
99 0.15
100 0.22
101 0.24
102 0.29
103 0.4
104 0.48
105 0.51
106 0.55
107 0.6
108 0.63
109 0.72
110 0.77
111 0.72
112 0.75
113 0.82
114 0.84
115 0.78
116 0.76
117 0.73
118 0.71
119 0.68
120 0.6
121 0.51
122 0.41
123 0.38
124 0.29
125 0.21
126 0.13