Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2D6V8

Protein Details
Accession A0A0D2D6V8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
134-162KLEEERKKALEQKKHKKAAKMLKGGRKTQBasic
NLS Segment(s)
PositionSequence
132-169AKKLEEERKKALEQKKHKKAAKMLKGGRKTQAPRQKGN
Subcellular Location(s) mito 8.5, cyto_mito 7.5, cyto 5.5, nucl 4, E.R. 3, plas 2, extr 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
CDD cd09917  F-box_SF  
Amino Acid Sequences MADNVAFRMPESILVTLRNAQSTSNGSFAVNLFHRLPAELWFMILSLTDYRTMVLMALSCKGMAAVVLNTQAFKFAAATEEAEHKTLGHHEYVIKCFNEKAESRSKLYCSHFLCPFYMKNIWTWAKNVKSVAKKLEEERKKALEQKKHKKAAKMLKGGRKTQAPRQKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.22
4 0.23
5 0.22
6 0.2
7 0.18
8 0.2
9 0.23
10 0.24
11 0.21
12 0.2
13 0.18
14 0.18
15 0.18
16 0.2
17 0.16
18 0.18
19 0.17
20 0.17
21 0.18
22 0.18
23 0.18
24 0.16
25 0.19
26 0.15
27 0.15
28 0.13
29 0.13
30 0.12
31 0.11
32 0.09
33 0.06
34 0.07
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.04
51 0.05
52 0.04
53 0.05
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.07
66 0.07
67 0.1
68 0.11
69 0.11
70 0.11
71 0.1
72 0.09
73 0.11
74 0.11
75 0.08
76 0.09
77 0.11
78 0.13
79 0.16
80 0.19
81 0.17
82 0.16
83 0.16
84 0.17
85 0.18
86 0.17
87 0.2
88 0.26
89 0.29
90 0.31
91 0.33
92 0.34
93 0.36
94 0.39
95 0.42
96 0.36
97 0.37
98 0.38
99 0.37
100 0.36
101 0.33
102 0.3
103 0.27
104 0.27
105 0.22
106 0.21
107 0.27
108 0.29
109 0.27
110 0.29
111 0.33
112 0.33
113 0.35
114 0.37
115 0.37
116 0.41
117 0.45
118 0.48
119 0.46
120 0.46
121 0.5
122 0.58
123 0.58
124 0.56
125 0.58
126 0.57
127 0.56
128 0.61
129 0.63
130 0.63
131 0.66
132 0.72
133 0.76
134 0.81
135 0.82
136 0.82
137 0.83
138 0.83
139 0.83
140 0.82
141 0.81
142 0.8
143 0.83
144 0.8
145 0.76
146 0.75
147 0.7
148 0.7
149 0.71