FuNGI

A0A0D2DJD4

Protein Details

Accession

A0A0D2DJD4

Localization Confidence

Low

Confidence Score

8.4

NoLS Segment(s)

Position	Sequence	Protein Nature
453-479	VTPRSLVTKREMKKNRKKEGLKVLSED	Hydrophilic

NLS Segment(s)

Position	Sequence
462-470	REMKKNRKK

Subcellular Location(s)

extr 10, plas 8, mito 3, golg 3, nucl 1, cyto 1, cyto_nucl 1, E.R. 1

Family & Domain DBs

Gene Ontology	GO:0016020 C:membrane

Amino Acid Sequences

MRCSSSVLVLSIFIFVLAISPATARPSSVWDFNIDNDPAPPPDQGPPISAGALRDRSKLKYEVVGIVGAYVVWLIVTFSLLFFVGKKLRRRIQTSNRSLSMEIMSKPAPLANQAGRPVEPPLKSPGKMASLKSWASGKSHAYKPSNVSVTSTIDEKILQADKAKNMDEMARLYAAVMQHDEEQSQKARSSGQTSPRTPNIPPQYSVPPTPRSIALPPTPRSPYYRPDITGTLSPRSPRSPGYPPEFQQQGDFIEPKSPRSPRLAHPLAPTPVEDPPTRLAHPMAPTPAEDPSTHTQSQPSIRKKVSPLSFISAQKRRPSNISVRGQGISQPLGSATLTEESYIDESQASPRFYNPGPPPPTPGQKSAVTVTQDEVGRRTPGAASLANTMASNGSSSSNSLPFRQFYNETLKSAPATKTTFVGVRESIIGVHPKTGVPQTPYSPYMPFTPMTPVTPRSLVTKREMKKNRKKEGLKVLSEDDIVLSDEDLWSPMK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.06
3	0.06
4	0.06
5	0.06
6	0.05
7	0.06
8	0.07
9	0.11
10	0.11
11	0.12
12	0.12
13	0.19
14	0.23
15	0.26
16	0.26
17	0.26
18	0.28
19	0.3
20	0.35
21	0.29
22	0.26
23	0.23
24	0.24
25	0.23
26	0.23
27	0.22
28	0.18
29	0.22
30	0.25
31	0.25
32	0.25
33	0.26
34	0.25
35	0.25
36	0.24
37	0.22
38	0.24
39	0.3
40	0.3
41	0.31
42	0.33
43	0.36
44	0.4
45	0.42
46	0.38
47	0.36
48	0.37
49	0.36
50	0.34
51	0.32
52	0.26
53	0.22
54	0.19
55	0.13
56	0.1
57	0.05
58	0.04
59	0.03
60	0.03
61	0.03
62	0.03
63	0.04
64	0.04
65	0.04
66	0.05
67	0.06
68	0.06
69	0.06
70	0.11
71	0.18
72	0.24
73	0.32
74	0.41
75	0.48
76	0.56
77	0.63
78	0.69
79	0.73
80	0.78
81	0.8
82	0.79
83	0.75
84	0.69
85	0.62
86	0.53
87	0.45
88	0.38
89	0.29
90	0.24
91	0.21
92	0.19
93	0.19
94	0.18
95	0.15
96	0.13
97	0.17
98	0.18
99	0.22
100	0.25
101	0.27
102	0.26
103	0.27
104	0.29
105	0.3
106	0.27
107	0.25
108	0.29
109	0.33
110	0.33
111	0.34
112	0.34
113	0.35
114	0.38
115	0.38
116	0.36
117	0.36
118	0.36
119	0.36
120	0.34
121	0.29
122	0.27
123	0.29
124	0.28
125	0.3
126	0.35
127	0.4
128	0.41
129	0.43
130	0.45
131	0.48
132	0.46
133	0.39
134	0.36
135	0.31
136	0.3
137	0.28
138	0.25
139	0.18
140	0.15
141	0.15
142	0.13
143	0.14
144	0.13
145	0.12
146	0.16
147	0.18
148	0.21
149	0.24
150	0.24
151	0.21
152	0.21
153	0.22
154	0.19
155	0.18
156	0.16
157	0.13
158	0.12
159	0.12
160	0.13
161	0.11
162	0.09
163	0.09
164	0.08
165	0.1
166	0.1
167	0.1
168	0.1
169	0.12
170	0.13
171	0.14
172	0.14
173	0.13
174	0.15
175	0.17
176	0.22
177	0.25
178	0.33
179	0.39
180	0.42
181	0.46
182	0.47
183	0.48
184	0.43
185	0.46
186	0.45
187	0.4
188	0.38
189	0.36
190	0.39
191	0.39
192	0.42
193	0.37
194	0.31
195	0.3
196	0.3
197	0.27
198	0.24
199	0.23
200	0.25
201	0.26
202	0.3
203	0.3
204	0.33
205	0.35
206	0.34
207	0.38
208	0.36
209	0.35
210	0.34
211	0.35
212	0.32
213	0.33
214	0.33
215	0.29
216	0.29
217	0.27
218	0.23
219	0.21
220	0.21
221	0.2
222	0.21
223	0.21
224	0.18
225	0.22
226	0.26
227	0.3
228	0.35
229	0.37
230	0.37
231	0.41
232	0.4
233	0.35
234	0.29
235	0.24
236	0.2
237	0.17
238	0.16
239	0.11
240	0.16
241	0.16
242	0.18
243	0.22
244	0.22
245	0.23
246	0.28
247	0.31
248	0.3
249	0.4
250	0.4
251	0.38
252	0.39
253	0.42
254	0.38
255	0.35
256	0.31
257	0.23
258	0.21
259	0.21
260	0.18
261	0.15
262	0.17
263	0.19
264	0.19
265	0.19
266	0.18
267	0.18
268	0.2
269	0.2
270	0.18
271	0.16
272	0.16
273	0.16
274	0.16
275	0.14
276	0.13
277	0.16
278	0.18
279	0.23
280	0.23
281	0.23
282	0.23
283	0.25
284	0.33
285	0.37
286	0.39
287	0.41
288	0.41
289	0.45
290	0.47
291	0.52
292	0.48
293	0.43
294	0.39
295	0.38
296	0.43
297	0.43
298	0.49
299	0.46
300	0.46
301	0.49
302	0.49
303	0.46
304	0.44
305	0.46
306	0.47
307	0.51
308	0.52
309	0.48
310	0.47
311	0.46
312	0.42
313	0.39
314	0.31
315	0.22
316	0.17
317	0.13
318	0.11
319	0.11
320	0.11
321	0.08
322	0.07
323	0.08
324	0.08
325	0.08
326	0.08
327	0.08
328	0.1
329	0.1
330	0.09
331	0.08
332	0.08
333	0.13
334	0.17
335	0.18
336	0.16
337	0.17
338	0.21
339	0.21
340	0.29
341	0.29
342	0.35
343	0.39
344	0.39
345	0.45
346	0.46
347	0.55
348	0.5
349	0.49
350	0.43
351	0.4
352	0.42
353	0.38
354	0.37
355	0.3
356	0.28
357	0.25
358	0.25
359	0.24
360	0.22
361	0.22
362	0.19
363	0.18
364	0.18
365	0.18
366	0.14
367	0.14
368	0.16
369	0.16
370	0.15
371	0.17
372	0.17
373	0.17
374	0.16
375	0.15
376	0.12
377	0.1
378	0.09
379	0.07
380	0.08
381	0.08
382	0.1
383	0.13
384	0.17
385	0.19
386	0.22
387	0.24
388	0.23
389	0.26
390	0.3
391	0.3
392	0.28
393	0.37
394	0.36
395	0.36
396	0.36
397	0.35
398	0.31
399	0.33
400	0.31
401	0.26
402	0.27
403	0.26
404	0.25
405	0.27
406	0.28
407	0.25
408	0.27
409	0.22
410	0.2
411	0.2
412	0.19
413	0.17
414	0.17
415	0.21
416	0.17
417	0.18
418	0.18
419	0.17
420	0.2
421	0.24
422	0.26
423	0.26
424	0.3
425	0.32
426	0.36
427	0.39
428	0.38
429	0.35
430	0.32
431	0.31
432	0.29
433	0.26
434	0.22
435	0.26
436	0.25
437	0.28
438	0.3
439	0.3
440	0.31
441	0.33
442	0.32
443	0.33
444	0.37
445	0.38
446	0.42
447	0.49
448	0.51
449	0.6
450	0.69
451	0.73
452	0.78
453	0.84
454	0.87
455	0.88
456	0.89
457	0.88
458	0.89
459	0.88
460	0.82
461	0.76
462	0.69
463	0.61
464	0.54
465	0.44
466	0.33
467	0.24
468	0.19
469	0.14
470	0.11
471	0.09
472	0.09
473	0.09

A0A0D2DJD4

3D AlphaFold-predicted Structure Viewer