Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2CSG2

Protein Details
Accession A0A0D2CSG2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
54-79SRTRVGDSRKRKKRMARKSTLTCTFAHydrophilic
NLS Segment(s)
PositionSequence
60-71DSRKRKKRMARK
Subcellular Location(s) nucl 13, mito 7, cyto 4, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTGRALVRSSNDDVRSAVYAVLNFILCGRVSRGIVQHDQEEAGLRWNDKRDLMSRTRVGDSRKRKKRMARKSTLTCTFACQSRNTEVGHRQGSRCGNCVHVRSKVVFVHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.24
4 0.2
5 0.14
6 0.13
7 0.13
8 0.13
9 0.11
10 0.09
11 0.09
12 0.09
13 0.08
14 0.08
15 0.1
16 0.11
17 0.12
18 0.14
19 0.17
20 0.2
21 0.23
22 0.24
23 0.23
24 0.2
25 0.2
26 0.18
27 0.16
28 0.13
29 0.14
30 0.13
31 0.13
32 0.14
33 0.16
34 0.17
35 0.16
36 0.18
37 0.17
38 0.22
39 0.25
40 0.28
41 0.29
42 0.3
43 0.31
44 0.32
45 0.33
46 0.37
47 0.44
48 0.49
49 0.57
50 0.61
51 0.66
52 0.73
53 0.79
54 0.81
55 0.81
56 0.8
57 0.8
58 0.82
59 0.84
60 0.8
61 0.72
62 0.61
63 0.55
64 0.48
65 0.42
66 0.35
67 0.29
68 0.27
69 0.28
70 0.31
71 0.28
72 0.3
73 0.32
74 0.37
75 0.42
76 0.41
77 0.38
78 0.42
79 0.49
80 0.46
81 0.45
82 0.39
83 0.39
84 0.42
85 0.46
86 0.45
87 0.43
88 0.44
89 0.42
90 0.47