Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FJE2

Protein Details
Accession A0A0D2FJE2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-107LLKVTVPKRTGRKRKRGSNEEFSEHHydrophilic
NLS Segment(s)
PositionSequence
90-98KRTGRKRKR
Subcellular Location(s) nucl 14.5, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR040454  TF_IIIC_Tfc1/Sfc1  
IPR041499  Tfc1/Sfc1_N  
IPR042536  TFIIIC_tauA_Sfc1  
Gene Ontology GO:0000127  C:transcription factor TFIIIC complex  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF17682  Tau95_N  
Amino Acid Sequences MSDPLRTVTAAPLFSIPNVPIVAVEHPCIVQNVDGAIRMLGGDSEIAEMLEPDNVKPLGLRFQPDDPTSREVVAYNKETNNLLLKVTVPKRTGRKRKRGSNEEFSEHPTGLSARKDVKYLLRSLKDNTQHCQAEFVGKIRSTHVWRTLPDFVYTSKGSMFLKEVRTKILPQDYPHLKQWSMPRALASAATDTEAIPPPVFSTQSLPRNFSYRQDPSVKTVTRKSTLGDAAVSAEVIPDQGQLGEEKQPEDSPAESGALLQTSDASAILT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.17
4 0.15
5 0.15
6 0.14
7 0.12
8 0.14
9 0.16
10 0.16
11 0.17
12 0.15
13 0.15
14 0.16
15 0.16
16 0.15
17 0.12
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.07
38 0.08
39 0.07
40 0.11
41 0.11
42 0.11
43 0.12
44 0.13
45 0.18
46 0.2
47 0.23
48 0.22
49 0.25
50 0.3
51 0.31
52 0.33
53 0.29
54 0.31
55 0.3
56 0.27
57 0.24
58 0.21
59 0.23
60 0.24
61 0.25
62 0.25
63 0.24
64 0.25
65 0.25
66 0.26
67 0.26
68 0.22
69 0.18
70 0.14
71 0.15
72 0.21
73 0.24
74 0.28
75 0.26
76 0.31
77 0.41
78 0.51
79 0.61
80 0.63
81 0.71
82 0.75
83 0.84
84 0.88
85 0.89
86 0.87
87 0.86
88 0.8
89 0.73
90 0.64
91 0.59
92 0.5
93 0.4
94 0.31
95 0.21
96 0.17
97 0.16
98 0.15
99 0.13
100 0.16
101 0.17
102 0.17
103 0.19
104 0.23
105 0.24
106 0.28
107 0.32
108 0.3
109 0.31
110 0.33
111 0.38
112 0.39
113 0.39
114 0.37
115 0.37
116 0.35
117 0.33
118 0.33
119 0.26
120 0.22
121 0.21
122 0.2
123 0.15
124 0.15
125 0.16
126 0.15
127 0.19
128 0.18
129 0.21
130 0.26
131 0.26
132 0.26
133 0.31
134 0.34
135 0.31
136 0.29
137 0.26
138 0.21
139 0.22
140 0.22
141 0.17
142 0.13
143 0.14
144 0.13
145 0.13
146 0.15
147 0.15
148 0.21
149 0.25
150 0.25
151 0.26
152 0.28
153 0.28
154 0.31
155 0.34
156 0.31
157 0.28
158 0.37
159 0.39
160 0.41
161 0.45
162 0.43
163 0.36
164 0.37
165 0.43
166 0.42
167 0.39
168 0.36
169 0.32
170 0.29
171 0.3
172 0.26
173 0.2
174 0.13
175 0.1
176 0.1
177 0.1
178 0.09
179 0.11
180 0.12
181 0.12
182 0.1
183 0.1
184 0.11
185 0.12
186 0.13
187 0.11
188 0.15
189 0.22
190 0.3
191 0.32
192 0.34
193 0.34
194 0.38
195 0.39
196 0.38
197 0.39
198 0.36
199 0.4
200 0.43
201 0.44
202 0.44
203 0.52
204 0.51
205 0.47
206 0.5
207 0.51
208 0.47
209 0.46
210 0.43
211 0.41
212 0.39
213 0.35
214 0.29
215 0.22
216 0.2
217 0.19
218 0.17
219 0.11
220 0.08
221 0.07
222 0.07
223 0.06
224 0.05
225 0.05
226 0.05
227 0.06
228 0.07
229 0.1
230 0.15
231 0.16
232 0.17
233 0.18
234 0.19
235 0.2
236 0.22
237 0.2
238 0.17
239 0.17
240 0.17
241 0.15
242 0.15
243 0.14
244 0.12
245 0.11
246 0.09
247 0.08
248 0.07
249 0.08