Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EBH4

Protein Details
Accession E9EBH4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-106DELKQRGKSAPKKKNGPPAEKPGRKRBasic
NLS Segment(s)
PositionSequence
85-106QRGKSAPKKKNGPPAEKPGRKR
Subcellular Location(s) mito 14.5, cyto_mito 11.5, cyto 7.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG maw:MAC_07222  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVTRARLLDLMKAQCQVFATTYNPEGVRMGNKVLRQRLKGPAVAAYYPRKVATIKDVKREFGPVLATWDEAEEDRFEYIDELKQRGKSAPKKKNGPPAEKPGRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.3
4 0.25
5 0.19
6 0.18
7 0.18
8 0.18
9 0.19
10 0.2
11 0.19
12 0.18
13 0.18
14 0.16
15 0.17
16 0.15
17 0.18
18 0.18
19 0.21
20 0.26
21 0.34
22 0.37
23 0.38
24 0.41
25 0.46
26 0.45
27 0.44
28 0.39
29 0.34
30 0.31
31 0.29
32 0.28
33 0.24
34 0.22
35 0.21
36 0.2
37 0.17
38 0.15
39 0.15
40 0.21
41 0.27
42 0.29
43 0.37
44 0.38
45 0.39
46 0.39
47 0.4
48 0.32
49 0.23
50 0.22
51 0.13
52 0.16
53 0.15
54 0.15
55 0.13
56 0.13
57 0.11
58 0.1
59 0.1
60 0.07
61 0.08
62 0.07
63 0.08
64 0.07
65 0.08
66 0.09
67 0.13
68 0.15
69 0.17
70 0.21
71 0.23
72 0.25
73 0.29
74 0.38
75 0.43
76 0.52
77 0.59
78 0.65
79 0.72
80 0.78
81 0.84
82 0.84
83 0.83
84 0.81
85 0.82
86 0.83