Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2FZ21

Protein Details
Accession A0A0D2FZ21    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-44LEAKKSTDLNKPQRRRVWRNFINRLKALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MADDTKDLILALLENQLEAKKSTDLNKPQRRRVWRNFINRLKALGEDIDSEDLEDNLPMLGKEELNGRQIRNAITTARQGSWPSTKGGRCYTKDLKGGQTDEERKKLEELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.11
5 0.12
6 0.13
7 0.13
8 0.16
9 0.21
10 0.3
11 0.39
12 0.49
13 0.59
14 0.64
15 0.71
16 0.77
17 0.82
18 0.83
19 0.83
20 0.83
21 0.81
22 0.84
23 0.85
24 0.84
25 0.81
26 0.72
27 0.64
28 0.53
29 0.45
30 0.35
31 0.25
32 0.18
33 0.12
34 0.11
35 0.1
36 0.09
37 0.09
38 0.08
39 0.07
40 0.07
41 0.05
42 0.04
43 0.03
44 0.04
45 0.03
46 0.04
47 0.05
48 0.05
49 0.05
50 0.09
51 0.11
52 0.15
53 0.17
54 0.16
55 0.18
56 0.19
57 0.2
58 0.18
59 0.18
60 0.15
61 0.16
62 0.2
63 0.2
64 0.19
65 0.2
66 0.2
67 0.22
68 0.26
69 0.25
70 0.24
71 0.28
72 0.3
73 0.33
74 0.4
75 0.44
76 0.43
77 0.5
78 0.54
79 0.55
80 0.59
81 0.57
82 0.55
83 0.54
84 0.52
85 0.48
86 0.5
87 0.52
88 0.54
89 0.57
90 0.53
91 0.48