Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2G224

Protein Details
Accession A0A0D2G224    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
491-516AGWSRSLRYAREKREKAKKGAKALADHydrophilic
NLS Segment(s)
PositionSequence
499-523YAREKREKAKKGAKALADEGKEKKE
Subcellular Location(s) mito 12.5, cyto_mito 8.5, nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015222  Tam41  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0004605  F:phosphatidate cytidylyltransferase activity  
GO:0032049  P:cardiolipin biosynthetic process  
GO:0016024  P:CDP-diacylglycerol biosynthetic process  
Pfam View protein in Pfam  
PF09139  Tam41_Mmp37  
Amino Acid Sequences MTLRVVPSVLGKRALTEVYGFPLASTIRRFPLGSGIRHYATLEEERGRADGPPPGFDAAKAKQNLNANPSKPPSPATGSTSSETKPSNDRSSSERTSSTYDWEENPDLSISKFSELPGKDFGVNQHIIINEEFKEALRQILWKFRAPIRYAFAYGSGVFPQSSGASGGNSKLHPNPPEAVMKVQDGNQKMIDFIFGVSYTQHWHSLNLQDNRDHYSWVGSLGSYAVTKIQDSFGAGVYFNPYITVNGTLIKYGVVNLDTLCRDLSEWDTLYLAGRLQKPVKILRDNPAVRLANQVNLIAAVRTALLLLPPEFTEKELYSTIAGISYMGDPRMTIGGDDPRKVNNIVTHQLPNFRRLYAPLIDNLPNITFNDPACSDRDWLNDPSVNAKLAQNMDPVTRGHMVRRLPNAFRHKLYFEYQSKFNIPRGEFNRMLEETKDEDPDRIRRREGGPFEQRIAQDTEGGGLREEVKQVIEHTIRWPSFMQSLKGPITAGWSRSLRYAREKREKAKKGAKALADEGKEKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.25
3 0.22
4 0.2
5 0.21
6 0.22
7 0.2
8 0.17
9 0.19
10 0.19
11 0.19
12 0.22
13 0.21
14 0.22
15 0.25
16 0.26
17 0.24
18 0.33
19 0.36
20 0.36
21 0.39
22 0.41
23 0.4
24 0.4
25 0.4
26 0.31
27 0.28
28 0.29
29 0.27
30 0.24
31 0.24
32 0.24
33 0.25
34 0.24
35 0.21
36 0.19
37 0.21
38 0.2
39 0.21
40 0.22
41 0.24
42 0.23
43 0.23
44 0.27
45 0.25
46 0.31
47 0.32
48 0.3
49 0.33
50 0.4
51 0.44
52 0.45
53 0.49
54 0.43
55 0.48
56 0.51
57 0.5
58 0.44
59 0.42
60 0.39
61 0.38
62 0.39
63 0.38
64 0.39
65 0.4
66 0.4
67 0.41
68 0.37
69 0.34
70 0.32
71 0.28
72 0.3
73 0.33
74 0.38
75 0.38
76 0.39
77 0.41
78 0.48
79 0.5
80 0.46
81 0.42
82 0.37
83 0.4
84 0.39
85 0.38
86 0.34
87 0.31
88 0.3
89 0.33
90 0.32
91 0.26
92 0.26
93 0.22
94 0.19
95 0.17
96 0.18
97 0.13
98 0.13
99 0.14
100 0.13
101 0.2
102 0.2
103 0.22
104 0.23
105 0.24
106 0.23
107 0.24
108 0.25
109 0.24
110 0.24
111 0.21
112 0.2
113 0.19
114 0.19
115 0.19
116 0.19
117 0.13
118 0.14
119 0.13
120 0.11
121 0.14
122 0.12
123 0.13
124 0.12
125 0.15
126 0.16
127 0.25
128 0.27
129 0.28
130 0.32
131 0.35
132 0.41
133 0.4
134 0.42
135 0.39
136 0.39
137 0.37
138 0.33
139 0.3
140 0.25
141 0.22
142 0.19
143 0.14
144 0.12
145 0.1
146 0.1
147 0.1
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1
155 0.12
156 0.13
157 0.15
158 0.18
159 0.22
160 0.23
161 0.25
162 0.25
163 0.25
164 0.29
165 0.27
166 0.25
167 0.22
168 0.22
169 0.2
170 0.22
171 0.24
172 0.22
173 0.23
174 0.22
175 0.2
176 0.19
177 0.18
178 0.14
179 0.1
180 0.08
181 0.07
182 0.06
183 0.06
184 0.06
185 0.06
186 0.08
187 0.09
188 0.12
189 0.12
190 0.13
191 0.15
192 0.22
193 0.3
194 0.32
195 0.33
196 0.32
197 0.33
198 0.37
199 0.35
200 0.29
201 0.2
202 0.17
203 0.15
204 0.14
205 0.13
206 0.08
207 0.07
208 0.07
209 0.07
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.07
216 0.07
217 0.07
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.09
225 0.09
226 0.08
227 0.08
228 0.07
229 0.07
230 0.08
231 0.09
232 0.07
233 0.09
234 0.09
235 0.08
236 0.08
237 0.08
238 0.07
239 0.06
240 0.07
241 0.05
242 0.05
243 0.05
244 0.08
245 0.08
246 0.08
247 0.08
248 0.07
249 0.07
250 0.07
251 0.09
252 0.09
253 0.09
254 0.09
255 0.09
256 0.09
257 0.09
258 0.09
259 0.08
260 0.1
261 0.11
262 0.13
263 0.15
264 0.16
265 0.19
266 0.24
267 0.28
268 0.3
269 0.32
270 0.35
271 0.44
272 0.43
273 0.41
274 0.44
275 0.39
276 0.34
277 0.37
278 0.31
279 0.24
280 0.24
281 0.22
282 0.14
283 0.14
284 0.14
285 0.07
286 0.07
287 0.04
288 0.04
289 0.03
290 0.04
291 0.03
292 0.03
293 0.04
294 0.05
295 0.05
296 0.06
297 0.08
298 0.08
299 0.09
300 0.12
301 0.11
302 0.13
303 0.13
304 0.13
305 0.12
306 0.12
307 0.11
308 0.08
309 0.08
310 0.05
311 0.06
312 0.06
313 0.07
314 0.06
315 0.06
316 0.06
317 0.07
318 0.08
319 0.07
320 0.06
321 0.07
322 0.15
323 0.18
324 0.19
325 0.2
326 0.2
327 0.22
328 0.23
329 0.23
330 0.19
331 0.22
332 0.24
333 0.26
334 0.29
335 0.28
336 0.36
337 0.35
338 0.36
339 0.32
340 0.3
341 0.27
342 0.25
343 0.29
344 0.24
345 0.24
346 0.21
347 0.24
348 0.24
349 0.23
350 0.22
351 0.18
352 0.15
353 0.15
354 0.14
355 0.12
356 0.11
357 0.14
358 0.14
359 0.15
360 0.16
361 0.17
362 0.17
363 0.18
364 0.21
365 0.22
366 0.23
367 0.25
368 0.25
369 0.24
370 0.26
371 0.25
372 0.23
373 0.2
374 0.19
375 0.19
376 0.2
377 0.21
378 0.19
379 0.19
380 0.19
381 0.2
382 0.19
383 0.19
384 0.2
385 0.19
386 0.2
387 0.24
388 0.27
389 0.31
390 0.39
391 0.41
392 0.41
393 0.49
394 0.56
395 0.56
396 0.56
397 0.54
398 0.48
399 0.46
400 0.47
401 0.48
402 0.45
403 0.44
404 0.43
405 0.43
406 0.46
407 0.44
408 0.45
409 0.43
410 0.38
411 0.43
412 0.46
413 0.49
414 0.46
415 0.45
416 0.48
417 0.42
418 0.42
419 0.33
420 0.32
421 0.28
422 0.28
423 0.3
424 0.24
425 0.26
426 0.29
427 0.38
428 0.43
429 0.44
430 0.44
431 0.45
432 0.49
433 0.56
434 0.58
435 0.58
436 0.59
437 0.59
438 0.59
439 0.58
440 0.54
441 0.48
442 0.45
443 0.35
444 0.27
445 0.23
446 0.23
447 0.19
448 0.2
449 0.16
450 0.13
451 0.15
452 0.14
453 0.15
454 0.13
455 0.13
456 0.13
457 0.15
458 0.21
459 0.21
460 0.21
461 0.24
462 0.33
463 0.32
464 0.33
465 0.33
466 0.28
467 0.33
468 0.36
469 0.34
470 0.29
471 0.35
472 0.35
473 0.35
474 0.32
475 0.25
476 0.29
477 0.29
478 0.27
479 0.28
480 0.28
481 0.28
482 0.34
483 0.39
484 0.37
485 0.44
486 0.52
487 0.57
488 0.66
489 0.74
490 0.77
491 0.84
492 0.88
493 0.88
494 0.88
495 0.86
496 0.84
497 0.83
498 0.78
499 0.73
500 0.71
501 0.68
502 0.61
503 0.59