Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BIY6

Protein Details
Accession Q6BIY6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRPSLVRLVRPRRPERKTSPILPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006094  P:gluconeogenesis  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
KEGG dha:DEHA2G06622g  -  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRPSLVRLVRPRRPERKTSPILPPLKLYKALLRAHANKLPVELRPLGDQYVKAEFKAHKNIDNPLHIVGFLAQWQDYLKGIDGGEWINGKLSQQDLEKMSPEQIGQLHELMEEAKKAGASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.8
4 0.8
5 0.76
6 0.76
7 0.75
8 0.73
9 0.65
10 0.61
11 0.55
12 0.51
13 0.47
14 0.39
15 0.35
16 0.37
17 0.38
18 0.38
19 0.4
20 0.42
21 0.45
22 0.46
23 0.43
24 0.35
25 0.36
26 0.31
27 0.24
28 0.24
29 0.19
30 0.17
31 0.17
32 0.18
33 0.17
34 0.16
35 0.16
36 0.14
37 0.19
38 0.18
39 0.16
40 0.19
41 0.2
42 0.23
43 0.32
44 0.31
45 0.29
46 0.3
47 0.35
48 0.35
49 0.35
50 0.31
51 0.23
52 0.22
53 0.17
54 0.16
55 0.11
56 0.08
57 0.07
58 0.06
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.09
70 0.08
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.1
79 0.12
80 0.12
81 0.17
82 0.18
83 0.2
84 0.22
85 0.21
86 0.22
87 0.2
88 0.19
89 0.17
90 0.16
91 0.17
92 0.17
93 0.16
94 0.15
95 0.14
96 0.14
97 0.13
98 0.12
99 0.11
100 0.09
101 0.1