Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2FXV0

Protein Details
Accession A0A0D2FXV0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-75DAEPTEGKPRRKRLSRLLSGGKKBasic
NLS Segment(s)
PositionSequence
59-75GKPRRKRLSRLLSGGKK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MPSRFTEILEPGYQTTSPQDDVRLEDIIGAANMSRGRESSEASSRSTSSSSGDAEPTEGKPRRKRLSRLLSGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.18
5 0.17
6 0.18
7 0.17
8 0.2
9 0.22
10 0.19
11 0.16
12 0.14
13 0.13
14 0.11
15 0.1
16 0.07
17 0.04
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.08
24 0.09
25 0.11
26 0.13
27 0.18
28 0.19
29 0.21
30 0.22
31 0.2
32 0.21
33 0.2
34 0.17
35 0.13
36 0.14
37 0.14
38 0.13
39 0.14
40 0.13
41 0.14
42 0.15
43 0.15
44 0.23
45 0.27
46 0.35
47 0.42
48 0.52
49 0.61
50 0.68
51 0.75
52 0.76
53 0.82
54 0.83
55 0.84