Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BWH1

Protein Details
Accession Q6BWH1    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-24TQVGDGKWCKRKDREEKREEITAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 13, nucl 8
Family & Domain DBs
KEGG dha:DEHA2B11418g  -  
Amino Acid Sequences MTQVGDGKWCKRKDREEKREEITASVKGTAGGGFVVVTEHSDAATRYQSIADVMGPVLRGCDVASATSTPKRGLAGERNCSTRIGHTTSVLLIVRRSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.81
4 0.83
5 0.8
6 0.78
7 0.68
8 0.6
9 0.51
10 0.43
11 0.35
12 0.28
13 0.23
14 0.16
15 0.16
16 0.12
17 0.1
18 0.06
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.07
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.07
52 0.08
53 0.1
54 0.13
55 0.14
56 0.14
57 0.14
58 0.15
59 0.15
60 0.21
61 0.28
62 0.33
63 0.41
64 0.43
65 0.46
66 0.46
67 0.45
68 0.4
69 0.36
70 0.33
71 0.3
72 0.29
73 0.27
74 0.28
75 0.27
76 0.29
77 0.26
78 0.21
79 0.17