Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2F4R0

Protein Details
Accession A0A0D2F4R0   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
64-83PQAVRTRKRKGAKDNAQGKVHydrophilic
NLS Segment(s)
PositionSequence
70-76RKRKGAK
105-129TKHARIKESAAEVVARAPLKGRKRK
159-186RARRTGKTKAHKTGKAGKPSKSSKRSHP
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MDPTPAGPAACSTSQSLPNQKTGWRELPTHSSTHGPFPAVRRVPYGADDFESHKALGETRVPFPQAVRTRKRKGAKDNAQGKVDKASPETERVHDAGGPAHVPRTKHARIKESAAEVVARAPLKGRKRKAIEIEDGDEDDQDYEYDDDDDDDGGDGGSRARRTGKTKAHKTGKAGKPSKSSKRSHPDHAGHGARDIRAFFHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.4
4 0.38
5 0.43
6 0.43
7 0.44
8 0.45
9 0.46
10 0.48
11 0.42
12 0.43
13 0.42
14 0.48
15 0.47
16 0.43
17 0.38
18 0.35
19 0.33
20 0.36
21 0.33
22 0.27
23 0.27
24 0.29
25 0.37
26 0.35
27 0.35
28 0.32
29 0.33
30 0.33
31 0.33
32 0.32
33 0.24
34 0.22
35 0.23
36 0.23
37 0.23
38 0.23
39 0.2
40 0.17
41 0.16
42 0.15
43 0.16
44 0.18
45 0.18
46 0.19
47 0.21
48 0.21
49 0.21
50 0.21
51 0.28
52 0.31
53 0.37
54 0.44
55 0.51
56 0.57
57 0.65
58 0.73
59 0.72
60 0.73
61 0.76
62 0.77
63 0.78
64 0.8
65 0.76
66 0.72
67 0.64
68 0.54
69 0.47
70 0.39
71 0.29
72 0.21
73 0.2
74 0.18
75 0.22
76 0.23
77 0.21
78 0.21
79 0.2
80 0.19
81 0.16
82 0.16
83 0.11
84 0.1
85 0.09
86 0.07
87 0.09
88 0.1
89 0.1
90 0.12
91 0.19
92 0.24
93 0.28
94 0.33
95 0.36
96 0.37
97 0.41
98 0.42
99 0.36
100 0.32
101 0.27
102 0.23
103 0.17
104 0.15
105 0.13
106 0.1
107 0.08
108 0.1
109 0.15
110 0.24
111 0.32
112 0.36
113 0.43
114 0.48
115 0.55
116 0.61
117 0.62
118 0.6
119 0.55
120 0.54
121 0.46
122 0.41
123 0.35
124 0.26
125 0.2
126 0.13
127 0.1
128 0.06
129 0.07
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.04
143 0.06
144 0.09
145 0.1
146 0.11
147 0.16
148 0.21
149 0.27
150 0.37
151 0.45
152 0.53
153 0.62
154 0.72
155 0.77
156 0.76
157 0.78
158 0.79
159 0.77
160 0.77
161 0.73
162 0.69
163 0.69
164 0.74
165 0.78
166 0.76
167 0.74
168 0.73
169 0.78
170 0.78
171 0.78
172 0.78
173 0.73
174 0.71
175 0.75
176 0.7
177 0.6
178 0.59
179 0.53
180 0.44
181 0.41
182 0.34