Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2CRS9

Protein Details
Accession A0A0D2CRS9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-37RIAIVNSDKCKPKKCRQECKKSCPVVRTGKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 8.5, cyto_nucl 8.333, cyto_mito 7.666, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017896  4Fe4S_Fe-S-bd  
IPR003593  AAA+_ATPase  
IPR003439  ABC_transporter-like_ATP-bd  
IPR017871  ABC_transporter-like_CS  
IPR027417  P-loop_NTPase  
IPR013283  RLI1  
IPR034348  RLI_dom_1  
IPR007209  RNaseL-inhib-like_metal-bd_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF00005  ABC_tran  
PF00037  Fer4  
PF04068  RLI  
PROSITE View protein in PROSITE  
PS51379  4FE4S_FER_2  
PS00211  ABC_TRANSPORTER_1  
PS50893  ABC_TRANSPORTER_2  
CDD cd03236  ABC_RNaseL_inhibitor_domain1  
Amino Acid Sequences MSDKLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAYISERLCIGCGICPKKCPFGAIHIINLPTNLETQVTHRYSANSFKLHRLPMPRPGQVLGLVGTNGIGKSTALKILSGKLKPNLGRYDNPPDWEEILKYFRGSELQNYFTKVLEDDLKAIVKPQYVDQLPRAIKGPVKTVKPLIEAKSELGNMKHIMDVLELNAVQDREISLLSGGELQRFAIALVCVQNADVYMFDEPSSYLDVKQRLSAARIIRELLRPNDYVIVVEHDLSVLDYLSDFICVLYGRPAVYGVVTLPASVREGINIFLDGNIPTENLRFREESLTFRIAEAGEDYMVDKARGFEYPAMEKTLGGFHLKINKGTFTDSEIIVMMGENGTGKTTFCKMLAGVEKPDGNQKIPPMNISMKPQKITPKFQGTVRQLFFKRIKASFLNPQFQTDVYKPLKLDDFIDQEVQNLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIIAARVIKRFIMHSKKTAFIVEHDFIMATYLADRVIVFDGTPSVNARANAPESLLTGCNKFLKNLDVTFRRDPNSFRPRINKYQSQLDQEQKLAGNYFFLEDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.65
4 0.68
5 0.7
6 0.74
7 0.8
8 0.85
9 0.87
10 0.93
11 0.94
12 0.94
13 0.94
14 0.93
15 0.88
16 0.83
17 0.82
18 0.81
19 0.78
20 0.73
21 0.68
22 0.64
23 0.62
24 0.56
25 0.47
26 0.43
27 0.39
28 0.36
29 0.34
30 0.29
31 0.25
32 0.25
33 0.24
34 0.2
35 0.19
36 0.23
37 0.2
38 0.22
39 0.24
40 0.23
41 0.23
42 0.23
43 0.19
44 0.18
45 0.25
46 0.29
47 0.29
48 0.36
49 0.39
50 0.46
51 0.46
52 0.44
53 0.38
54 0.4
55 0.48
56 0.44
57 0.44
58 0.4
59 0.4
60 0.37
61 0.35
62 0.28
63 0.18
64 0.17
65 0.14
66 0.11
67 0.1
68 0.13
69 0.22
70 0.23
71 0.24
72 0.24
73 0.27
74 0.29
75 0.37
76 0.39
77 0.36
78 0.37
79 0.43
80 0.47
81 0.48
82 0.5
83 0.5
84 0.49
85 0.52
86 0.57
87 0.53
88 0.5
89 0.47
90 0.44
91 0.37
92 0.33
93 0.24
94 0.17
95 0.14
96 0.11
97 0.1
98 0.1
99 0.08
100 0.07
101 0.06
102 0.05
103 0.08
104 0.09
105 0.12
106 0.12
107 0.13
108 0.14
109 0.2
110 0.28
111 0.28
112 0.31
113 0.32
114 0.38
115 0.4
116 0.46
117 0.48
118 0.45
119 0.47
120 0.48
121 0.55
122 0.51
123 0.51
124 0.45
125 0.39
126 0.37
127 0.33
128 0.28
129 0.21
130 0.22
131 0.2
132 0.19
133 0.17
134 0.15
135 0.17
136 0.17
137 0.21
138 0.23
139 0.26
140 0.27
141 0.3
142 0.3
143 0.27
144 0.27
145 0.2
146 0.18
147 0.17
148 0.17
149 0.15
150 0.16
151 0.17
152 0.16
153 0.18
154 0.17
155 0.15
156 0.15
157 0.15
158 0.21
159 0.21
160 0.24
161 0.24
162 0.31
163 0.3
164 0.3
165 0.3
166 0.24
167 0.26
168 0.25
169 0.31
170 0.29
171 0.31
172 0.33
173 0.35
174 0.36
175 0.37
176 0.41
177 0.35
178 0.33
179 0.31
180 0.3
181 0.29
182 0.28
183 0.25
184 0.2
185 0.2
186 0.17
187 0.16
188 0.15
189 0.12
190 0.11
191 0.1
192 0.1
193 0.08
194 0.08
195 0.08
196 0.07
197 0.09
198 0.08
199 0.07
200 0.07
201 0.07
202 0.06
203 0.06
204 0.07
205 0.05
206 0.05
207 0.05
208 0.09
209 0.09
210 0.08
211 0.09
212 0.08
213 0.08
214 0.08
215 0.08
216 0.06
217 0.05
218 0.06
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.06
225 0.06
226 0.05
227 0.05
228 0.05
229 0.06
230 0.06
231 0.06
232 0.06
233 0.07
234 0.09
235 0.08
236 0.1
237 0.13
238 0.16
239 0.16
240 0.17
241 0.19
242 0.17
243 0.19
244 0.22
245 0.21
246 0.22
247 0.22
248 0.22
249 0.21
250 0.24
251 0.26
252 0.23
253 0.24
254 0.21
255 0.21
256 0.22
257 0.2
258 0.17
259 0.13
260 0.13
261 0.1
262 0.1
263 0.09
264 0.07
265 0.07
266 0.07
267 0.07
268 0.03
269 0.03
270 0.03
271 0.04
272 0.04
273 0.04
274 0.04
275 0.03
276 0.04
277 0.04
278 0.04
279 0.06
280 0.06
281 0.06
282 0.06
283 0.07
284 0.06
285 0.06
286 0.06
287 0.04
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.06
294 0.06
295 0.06
296 0.05
297 0.06
298 0.07
299 0.07
300 0.07
301 0.06
302 0.06
303 0.07
304 0.06
305 0.06
306 0.06
307 0.06
308 0.06
309 0.07
310 0.08
311 0.09
312 0.11
313 0.11
314 0.12
315 0.17
316 0.18
317 0.2
318 0.23
319 0.24
320 0.21
321 0.21
322 0.21
323 0.16
324 0.14
325 0.12
326 0.08
327 0.06
328 0.06
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.06
335 0.07
336 0.08
337 0.09
338 0.1
339 0.12
340 0.16
341 0.17
342 0.18
343 0.17
344 0.17
345 0.16
346 0.15
347 0.14
348 0.12
349 0.11
350 0.11
351 0.19
352 0.2
353 0.21
354 0.21
355 0.21
356 0.21
357 0.22
358 0.21
359 0.17
360 0.18
361 0.15
362 0.15
363 0.13
364 0.12
365 0.1
366 0.1
367 0.06
368 0.04
369 0.04
370 0.04
371 0.03
372 0.04
373 0.04
374 0.05
375 0.07
376 0.09
377 0.1
378 0.1
379 0.11
380 0.1
381 0.16
382 0.21
383 0.21
384 0.21
385 0.22
386 0.23
387 0.22
388 0.29
389 0.25
390 0.21
391 0.21
392 0.23
393 0.26
394 0.25
395 0.26
396 0.24
397 0.27
398 0.28
399 0.33
400 0.38
401 0.36
402 0.36
403 0.39
404 0.44
405 0.46
406 0.5
407 0.51
408 0.52
409 0.51
410 0.54
411 0.6
412 0.56
413 0.59
414 0.53
415 0.53
416 0.45
417 0.51
418 0.51
419 0.47
420 0.47
421 0.4
422 0.43
423 0.39
424 0.43
425 0.44
426 0.48
427 0.49
428 0.44
429 0.45
430 0.41
431 0.38
432 0.38
433 0.3
434 0.32
435 0.26
436 0.28
437 0.26
438 0.28
439 0.3
440 0.26
441 0.27
442 0.23
443 0.25
444 0.24
445 0.27
446 0.24
447 0.23
448 0.23
449 0.21
450 0.15
451 0.11
452 0.1
453 0.1
454 0.11
455 0.1
456 0.1
457 0.1
458 0.1
459 0.1
460 0.09
461 0.06
462 0.05
463 0.05
464 0.04
465 0.04
466 0.04
467 0.03
468 0.03
469 0.03
470 0.03
471 0.03
472 0.04
473 0.04
474 0.05
475 0.06
476 0.06
477 0.06
478 0.07
479 0.08
480 0.07
481 0.08
482 0.1
483 0.11
484 0.13
485 0.13
486 0.12
487 0.13
488 0.14
489 0.17
490 0.21
491 0.23
492 0.26
493 0.28
494 0.29
495 0.28
496 0.31
497 0.38
498 0.41
499 0.42
500 0.46
501 0.47
502 0.5
503 0.5
504 0.49
505 0.41
506 0.35
507 0.38
508 0.31
509 0.28
510 0.25
511 0.23
512 0.19
513 0.2
514 0.16
515 0.08
516 0.07
517 0.07
518 0.07
519 0.07
520 0.07
521 0.07
522 0.09
523 0.09
524 0.08
525 0.08
526 0.11
527 0.11
528 0.12
529 0.12
530 0.13
531 0.17
532 0.17
533 0.19
534 0.21
535 0.23
536 0.23
537 0.22
538 0.2
539 0.19
540 0.21
541 0.21
542 0.18
543 0.17
544 0.2
545 0.25
546 0.24
547 0.25
548 0.25
549 0.29
550 0.32
551 0.35
552 0.41
553 0.41
554 0.47
555 0.53
556 0.55
557 0.53
558 0.51
559 0.52
560 0.54
561 0.58
562 0.57
563 0.57
564 0.62
565 0.67
566 0.74
567 0.79
568 0.77
569 0.71
570 0.77
571 0.75
572 0.74
573 0.73
574 0.7
575 0.65
576 0.58
577 0.56
578 0.47
579 0.43
580 0.38
581 0.3
582 0.23
583 0.2
584 0.2