FuNGI

A0A0D2CG01

Protein Details

Accession

A0A0D2CG01

Localization Confidence

Medium

Confidence Score

10.7

NoLS Segment(s)

Position	Sequence	Protein Nature
48-71	ADPSFSRKFEPRRRALHSRSRLIR	Hydrophilic
418-440	EEMEREKREREKQEKEKADQAKK	Basic

NLS Segment(s)

Subcellular Location(s)

nucl 10, plas 6, cyto_nucl 6, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR029044 Nucleotide-diphossugar_trans
Gene Ontology	GO:0016020 C:membrane GO:0048856 P:anatomical structure development GO:0043934 P:sporulation
Pfam	View protein in Pfam PF03452 Anp1

Amino Acid Sequences

MNRHHAFANGYAANKKRDDDVYHPYNDRGDLENKYIFGMPDLLEDEKADPSFSRKFEPRRRALHSRSRLIRLGLFALAVLTLAFYFLFPSASTLSLLSSSSTPASYYDDIETLRYYDLEDVQGTSVGWEREERVLLCTPLRDAAPHLPMFFEHLRNFTYPHHLIDLAFLVSDSKDNTEELLSRLLEEVQNDPDPSQPYGEISVIHKDFGQAVSQDVESRHGFAAQASRRKLMARARNWLLSAALRPYHSWVYWRDADVETCPYTIIEDLMRHDKDIIVPNIWRPLPDWLGGEQPYDLNSWQESETAIALAETLDEDAVIVEGYAEYATWRPHLAYLRDPYGDPDVEMELDGVGGVSILAKARVFRAGVHFPAFSFERHAETEGFGKMARRMKFSVVGLPHYTVWHLYEPSVDDIRHMEEMEREKREREKQEKEKADQAKKLEDEFTQVGSQWEKDKEAMMGGGTKEIDGGQTPTTKDGETTEKKVPAAKDEDGAKNS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.38
3	0.36
4	0.39
5	0.42
6	0.43
7	0.48
8	0.49
9	0.53
10	0.54
11	0.51
12	0.47
13	0.42
14	0.38
15	0.33
16	0.32
17	0.3
18	0.33
19	0.33
20	0.31
21	0.31
22	0.3
23	0.25
24	0.22
25	0.2
26	0.15
27	0.16
28	0.18
29	0.17
30	0.16
31	0.17
32	0.17
33	0.17
34	0.17
35	0.15
36	0.14
37	0.18
38	0.24
39	0.25
40	0.31
41	0.36
42	0.47
43	0.56
44	0.66
45	0.7
46	0.72
47	0.79
48	0.82
49	0.83
50	0.83
51	0.82
52	0.82
53	0.8
54	0.77
55	0.72
56	0.64
57	0.57
58	0.49
59	0.42
60	0.32
61	0.25
62	0.18
63	0.15
64	0.12
65	0.09
66	0.06
67	0.04
68	0.03
69	0.04
70	0.04
71	0.04
72	0.05
73	0.05
74	0.06
75	0.06
76	0.09
77	0.09
78	0.1
79	0.11
80	0.1
81	0.11
82	0.11
83	0.11
84	0.1
85	0.09
86	0.1
87	0.1
88	0.1
89	0.1
90	0.1
91	0.15
92	0.15
93	0.16
94	0.16
95	0.17
96	0.17
97	0.18
98	0.17
99	0.13
100	0.13
101	0.11
102	0.1
103	0.11
104	0.11
105	0.12
106	0.12
107	0.11
108	0.11
109	0.12
110	0.11
111	0.1
112	0.11
113	0.1
114	0.1
115	0.1
116	0.12
117	0.14
118	0.16
119	0.16
120	0.17
121	0.19
122	0.2
123	0.2
124	0.18
125	0.17
126	0.17
127	0.16
128	0.13
129	0.14
130	0.18
131	0.22
132	0.22
133	0.22
134	0.2
135	0.2
136	0.25
137	0.24
138	0.23
139	0.19
140	0.2
141	0.22
142	0.22
143	0.24
144	0.2
145	0.26
146	0.23
147	0.23
148	0.23
149	0.22
150	0.21
151	0.2
152	0.2
153	0.12
154	0.1
155	0.08
156	0.07
157	0.07
158	0.07
159	0.07
160	0.07
161	0.07
162	0.08
163	0.09
164	0.09
165	0.1
166	0.11
167	0.13
168	0.11
169	0.11
170	0.11
171	0.12
172	0.11
173	0.12
174	0.12
175	0.12
176	0.14
177	0.13
178	0.13
179	0.15
180	0.17
181	0.16
182	0.15
183	0.12
184	0.12
185	0.13
186	0.13
187	0.12
188	0.11
189	0.16
190	0.15
191	0.15
192	0.14
193	0.13
194	0.14
195	0.13
196	0.13
197	0.08
198	0.08
199	0.09
200	0.09
201	0.1
202	0.1
203	0.13
204	0.11
205	0.13
206	0.12
207	0.11
208	0.11
209	0.1
210	0.18
211	0.19
212	0.25
213	0.25
214	0.26
215	0.27
216	0.27
217	0.31
218	0.32
219	0.36
220	0.34
221	0.4
222	0.42
223	0.43
224	0.42
225	0.37
226	0.3
227	0.22
228	0.19
229	0.13
230	0.12
231	0.11
232	0.11
233	0.13
234	0.14
235	0.13
236	0.15
237	0.15
238	0.19
239	0.2
240	0.2
241	0.2
242	0.19
243	0.2
244	0.18
245	0.19
246	0.14
247	0.13
248	0.12
249	0.09
250	0.09
251	0.08
252	0.08
253	0.06
254	0.06
255	0.08
256	0.14
257	0.14
258	0.14
259	0.14
260	0.14
261	0.16
262	0.21
263	0.21
264	0.17
265	0.17
266	0.18
267	0.23
268	0.22
269	0.2
270	0.15
271	0.17
272	0.17
273	0.18
274	0.18
275	0.14
276	0.18
277	0.18
278	0.17
279	0.13
280	0.12
281	0.11
282	0.11
283	0.1
284	0.08
285	0.08
286	0.09
287	0.09
288	0.09
289	0.08
290	0.08
291	0.08
292	0.07
293	0.07
294	0.05
295	0.04
296	0.04
297	0.04
298	0.03
299	0.03
300	0.03
301	0.03
302	0.03
303	0.03
304	0.03
305	0.03
306	0.02
307	0.02
308	0.02
309	0.03
310	0.03
311	0.03
312	0.03
313	0.05
314	0.06
315	0.07
316	0.07
317	0.08
318	0.12
319	0.17
320	0.19
321	0.24
322	0.27
323	0.3
324	0.3
325	0.3
326	0.29
327	0.28
328	0.25
329	0.19
330	0.16
331	0.13
332	0.13
333	0.12
334	0.1
335	0.06
336	0.06
337	0.05
338	0.04
339	0.03
340	0.03
341	0.02
342	0.02
343	0.03
344	0.03
345	0.04
346	0.05
347	0.06
348	0.07
349	0.1
350	0.1
351	0.12
352	0.18
353	0.22
354	0.24
355	0.26
356	0.25
357	0.22
358	0.26
359	0.25
360	0.19
361	0.19
362	0.18
363	0.19
364	0.2
365	0.22
366	0.19
367	0.19
368	0.21
369	0.17
370	0.17
371	0.14
372	0.15
373	0.19
374	0.25
375	0.26
376	0.28
377	0.29
378	0.32
379	0.37
380	0.36
381	0.38
382	0.34
383	0.36
384	0.33
385	0.33
386	0.31
387	0.26
388	0.25
389	0.19
390	0.18
391	0.17
392	0.16
393	0.14
394	0.15
395	0.17
396	0.21
397	0.23
398	0.2
399	0.18
400	0.19
401	0.21
402	0.21
403	0.19
404	0.16
405	0.18
406	0.26
407	0.32
408	0.37
409	0.36
410	0.39
411	0.47
412	0.55
413	0.6
414	0.62
415	0.66
416	0.71
417	0.8
418	0.84
419	0.81
420	0.81
421	0.8
422	0.79
423	0.74
424	0.68
425	0.65
426	0.59
427	0.56
428	0.5
429	0.41
430	0.38
431	0.34
432	0.32
433	0.25
434	0.23
435	0.23
436	0.22
437	0.24
438	0.23
439	0.24
440	0.23
441	0.23
442	0.24
443	0.23
444	0.22
445	0.21
446	0.16
447	0.18
448	0.16
449	0.18
450	0.16
451	0.15
452	0.14
453	0.13
454	0.13
455	0.11
456	0.13
457	0.13
458	0.17
459	0.18
460	0.21
461	0.22
462	0.21
463	0.21
464	0.22
465	0.29
466	0.32
467	0.37
468	0.41
469	0.43
470	0.44
471	0.49
472	0.48
473	0.45
474	0.45
475	0.42
476	0.4
477	0.44

A0A0D2CG01

3D AlphaFold-predicted Structure Viewer