Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3QPY3

Protein Details
Accession A0A0C3QPY3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-124YQPSQRVRKRRHGFLARLRSKKGRLILARRRAKGRKBasic
NLS Segment(s)
PositionSequence
94-124RVRKRRHGFLARLRSKKGRLILARRRAKGRK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRISPFSLLRQLPRANVSRTILPTSSYSIARSTQSLLTPRRTLTLLTSSSSPTSFLYRSGLFLGQSSSSQGSALPTVQARHTTFGAEYQPSQRVRKRRHGFLARLRSKKGRLILARRRAKGRKYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.4
4 0.43
5 0.42
6 0.4
7 0.41
8 0.41
9 0.35
10 0.32
11 0.3
12 0.28
13 0.28
14 0.23
15 0.21
16 0.19
17 0.21
18 0.2
19 0.2
20 0.18
21 0.17
22 0.2
23 0.25
24 0.27
25 0.3
26 0.31
27 0.31
28 0.3
29 0.28
30 0.26
31 0.22
32 0.24
33 0.2
34 0.19
35 0.2
36 0.19
37 0.19
38 0.19
39 0.16
40 0.11
41 0.12
42 0.12
43 0.11
44 0.13
45 0.12
46 0.13
47 0.14
48 0.13
49 0.11
50 0.11
51 0.11
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.14
67 0.14
68 0.16
69 0.16
70 0.16
71 0.15
72 0.17
73 0.18
74 0.15
75 0.16
76 0.17
77 0.23
78 0.25
79 0.31
80 0.35
81 0.42
82 0.48
83 0.58
84 0.63
85 0.66
86 0.73
87 0.77
88 0.8
89 0.81
90 0.84
91 0.83
92 0.8
93 0.76
94 0.73
95 0.67
96 0.65
97 0.6
98 0.58
99 0.59
100 0.64
101 0.69
102 0.73
103 0.78
104 0.77
105 0.81
106 0.8
107 0.77
108 0.77