Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PXR5

Protein Details
Accession A0A0C3PXR5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-40PKPAETPKDKPPQRGPPPGEKKVLBasic
NLS Segment(s)
PositionSequence
22-87TPKDKPPQRGPPPGEKKVLTKAERREIQEAQRAAKEAAKSQTAAGKGGGGGGKGKQAPAVQKKPPA
Subcellular Location(s) cyto 13, cyto_nucl 11.5, pero 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000649  IF-2B-related  
IPR042529  IF_2B-like_C  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:1901566  P:organonitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF01008  IF-2B  
Amino Acid Sequences MDGVGNPSSSTAGPSVPKPAETPKDKPPQRGPPPGEKKVLTKAERREIQEAQRAAKEAAKSQTAAGKGGGGGGKGKQAPAVQKKPPAAAGPSKTQSEVNIAALHHPKSTTAASIETASTAPPPETLLRIFSHFALPKPLPSLGTGIKGDIHPVIRKLGLQFADFRIVGANARCIAALTAFKTVIQDYQTPAGTTLSRHLMTYLSPQISYLTAARPMSMSTGNAVRYLKYEISILGIDLPEQDAKDFLCERIDTYIRERIILADQVIRTAAMEKIRDGDTILVYARSSVVEKTILAAWDAGRRFNVVVIDSRPLLEGKALLASLTSASIPATYALLSSLPSLLPTVKTVILGAHALHANGSLYSRAGTAIVAMMAKSHQVPVIVCCETYKFSDTVLLDSFMKNEIAPNPTTGLTDTDRSLQALSPLYDLTPHTNITAVVTEVGLIPATAVPTVVARSFQGSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.26
4 0.27
5 0.28
6 0.36
7 0.42
8 0.47
9 0.5
10 0.52
11 0.62
12 0.66
13 0.72
14 0.74
15 0.75
16 0.78
17 0.83
18 0.8
19 0.8
20 0.84
21 0.82
22 0.79
23 0.71
24 0.66
25 0.65
26 0.68
27 0.63
28 0.61
29 0.63
30 0.66
31 0.7
32 0.7
33 0.67
34 0.63
35 0.65
36 0.66
37 0.6
38 0.54
39 0.5
40 0.47
41 0.42
42 0.4
43 0.34
44 0.31
45 0.33
46 0.31
47 0.29
48 0.28
49 0.32
50 0.29
51 0.28
52 0.22
53 0.18
54 0.16
55 0.18
56 0.17
57 0.12
58 0.13
59 0.13
60 0.17
61 0.17
62 0.17
63 0.18
64 0.2
65 0.3
66 0.38
67 0.45
68 0.46
69 0.52
70 0.55
71 0.54
72 0.54
73 0.48
74 0.43
75 0.43
76 0.41
77 0.42
78 0.43
79 0.42
80 0.4
81 0.37
82 0.33
83 0.3
84 0.27
85 0.21
86 0.21
87 0.19
88 0.23
89 0.27
90 0.27
91 0.23
92 0.21
93 0.19
94 0.2
95 0.21
96 0.17
97 0.15
98 0.15
99 0.15
100 0.16
101 0.16
102 0.13
103 0.12
104 0.11
105 0.1
106 0.1
107 0.09
108 0.08
109 0.1
110 0.1
111 0.12
112 0.13
113 0.15
114 0.15
115 0.18
116 0.19
117 0.17
118 0.22
119 0.22
120 0.22
121 0.26
122 0.25
123 0.24
124 0.25
125 0.25
126 0.2
127 0.19
128 0.22
129 0.17
130 0.2
131 0.19
132 0.17
133 0.17
134 0.16
135 0.17
136 0.15
137 0.16
138 0.14
139 0.15
140 0.16
141 0.15
142 0.17
143 0.16
144 0.19
145 0.18
146 0.17
147 0.19
148 0.18
149 0.21
150 0.2
151 0.19
152 0.15
153 0.13
154 0.14
155 0.13
156 0.13
157 0.1
158 0.1
159 0.1
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.1
166 0.1
167 0.1
168 0.11
169 0.11
170 0.11
171 0.12
172 0.12
173 0.12
174 0.15
175 0.15
176 0.14
177 0.15
178 0.14
179 0.12
180 0.11
181 0.13
182 0.14
183 0.13
184 0.13
185 0.13
186 0.12
187 0.13
188 0.16
189 0.18
190 0.15
191 0.14
192 0.15
193 0.15
194 0.15
195 0.15
196 0.12
197 0.08
198 0.11
199 0.11
200 0.11
201 0.1
202 0.1
203 0.11
204 0.1
205 0.09
206 0.08
207 0.1
208 0.11
209 0.13
210 0.13
211 0.11
212 0.12
213 0.14
214 0.13
215 0.11
216 0.11
217 0.09
218 0.1
219 0.1
220 0.08
221 0.07
222 0.06
223 0.06
224 0.06
225 0.06
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.07
232 0.08
233 0.08
234 0.09
235 0.09
236 0.09
237 0.13
238 0.15
239 0.14
240 0.17
241 0.21
242 0.2
243 0.2
244 0.2
245 0.17
246 0.17
247 0.17
248 0.14
249 0.12
250 0.12
251 0.12
252 0.12
253 0.1
254 0.09
255 0.09
256 0.1
257 0.09
258 0.1
259 0.1
260 0.13
261 0.14
262 0.14
263 0.13
264 0.12
265 0.1
266 0.1
267 0.1
268 0.08
269 0.07
270 0.08
271 0.07
272 0.06
273 0.07
274 0.06
275 0.07
276 0.08
277 0.08
278 0.09
279 0.1
280 0.1
281 0.09
282 0.1
283 0.09
284 0.14
285 0.14
286 0.14
287 0.12
288 0.13
289 0.13
290 0.14
291 0.14
292 0.1
293 0.13
294 0.14
295 0.16
296 0.15
297 0.15
298 0.14
299 0.13
300 0.12
301 0.1
302 0.08
303 0.07
304 0.08
305 0.07
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.05
312 0.04
313 0.04
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.06
322 0.06
323 0.06
324 0.06
325 0.06
326 0.06
327 0.07
328 0.08
329 0.08
330 0.09
331 0.11
332 0.11
333 0.11
334 0.11
335 0.11
336 0.11
337 0.11
338 0.1
339 0.1
340 0.1
341 0.1
342 0.1
343 0.1
344 0.09
345 0.08
346 0.09
347 0.07
348 0.07
349 0.07
350 0.07
351 0.07
352 0.07
353 0.07
354 0.06
355 0.06
356 0.07
357 0.06
358 0.06
359 0.06
360 0.06
361 0.07
362 0.08
363 0.08
364 0.08
365 0.1
366 0.11
367 0.13
368 0.18
369 0.18
370 0.17
371 0.17
372 0.18
373 0.19
374 0.21
375 0.22
376 0.16
377 0.16
378 0.22
379 0.22
380 0.23
381 0.23
382 0.22
383 0.2
384 0.2
385 0.21
386 0.16
387 0.16
388 0.13
389 0.14
390 0.16
391 0.19
392 0.19
393 0.2
394 0.21
395 0.21
396 0.22
397 0.2
398 0.2
399 0.19
400 0.21
401 0.2
402 0.22
403 0.22
404 0.22
405 0.22
406 0.19
407 0.2
408 0.21
409 0.21
410 0.18
411 0.18
412 0.17
413 0.18
414 0.19
415 0.21
416 0.19
417 0.19
418 0.18
419 0.19
420 0.19
421 0.19
422 0.19
423 0.14
424 0.12
425 0.11
426 0.11
427 0.1
428 0.11
429 0.08
430 0.06
431 0.06
432 0.06
433 0.07
434 0.07
435 0.06
436 0.06
437 0.08
438 0.1
439 0.1
440 0.11
441 0.11