Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3LHU5

Protein Details
Accession A0A0C3LHU5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
109-130CLLNGKGCKKDKKEAAKWYRAAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences GGCGVGMLMWGLALRSGWGVEKDEKRGFKWLRRAAEHAVEDMELAKNGKGAVGAMGGAVQTELVLAIYEVGQCFFHGWGVKQDKAMAVSYFQVAAKLGDPDAQQELAFCLLNGKGCKKDKKEAAKWYRAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.07
5 0.09
6 0.13
7 0.21
8 0.24
9 0.31
10 0.37
11 0.39
12 0.39
13 0.47
14 0.49
15 0.49
16 0.56
17 0.57
18 0.58
19 0.6
20 0.62
21 0.57
22 0.58
23 0.51
24 0.42
25 0.34
26 0.27
27 0.23
28 0.19
29 0.15
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.07
64 0.08
65 0.16
66 0.2
67 0.21
68 0.21
69 0.22
70 0.21
71 0.22
72 0.23
73 0.15
74 0.11
75 0.11
76 0.11
77 0.12
78 0.11
79 0.09
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.11
87 0.12
88 0.14
89 0.14
90 0.13
91 0.12
92 0.13
93 0.12
94 0.12
95 0.09
96 0.09
97 0.1
98 0.15
99 0.18
100 0.21
101 0.28
102 0.36
103 0.46
104 0.5
105 0.59
106 0.64
107 0.72
108 0.78
109 0.8
110 0.83