Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PMU7

Protein Details
Accession A0A0C3PMU7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
84-106EDDDTKPRRGRPRKKPAAERGDTBasic
NLS Segment(s)
PositionSequence
89-104KPRRGRPRKKPAAERG
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046496  DUF6589  
Pfam View protein in Pfam  
PF20231  DUF6589  
Amino Acid Sequences MNNKSAASKSLRSAKGPSWHDLKEVIEHTLEARVLLRWLKYSGCATLDDLRHWKPSPDELRKAAEEIVIEWASEKHIGDALDSEDDDTKPRRGRPRKKPAAERGDTVKAKPLAEKNDLTIKRNETLLMRDCLIFHELLAAAKCGDTGRLVDLVPILAQMFKAGGHAKYAVVMLEFAQRLTKEWPDDVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.53
4 0.51
5 0.48
6 0.46
7 0.44
8 0.42
9 0.37
10 0.33
11 0.31
12 0.27
13 0.21
14 0.21
15 0.19
16 0.2
17 0.18
18 0.12
19 0.12
20 0.1
21 0.12
22 0.15
23 0.15
24 0.14
25 0.16
26 0.16
27 0.18
28 0.19
29 0.19
30 0.18
31 0.18
32 0.19
33 0.24
34 0.24
35 0.25
36 0.27
37 0.27
38 0.3
39 0.3
40 0.29
41 0.25
42 0.33
43 0.4
44 0.43
45 0.47
46 0.46
47 0.49
48 0.48
49 0.47
50 0.38
51 0.29
52 0.2
53 0.16
54 0.17
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.11
61 0.1
62 0.06
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.08
69 0.08
70 0.08
71 0.07
72 0.08
73 0.09
74 0.11
75 0.14
76 0.16
77 0.22
78 0.32
79 0.41
80 0.52
81 0.61
82 0.71
83 0.77
84 0.82
85 0.87
86 0.86
87 0.86
88 0.77
89 0.69
90 0.63
91 0.6
92 0.53
93 0.43
94 0.4
95 0.31
96 0.3
97 0.31
98 0.3
99 0.27
100 0.31
101 0.31
102 0.27
103 0.35
104 0.36
105 0.35
106 0.34
107 0.32
108 0.29
109 0.29
110 0.28
111 0.2
112 0.24
113 0.25
114 0.23
115 0.21
116 0.2
117 0.19
118 0.2
119 0.2
120 0.14
121 0.1
122 0.1
123 0.09
124 0.1
125 0.11
126 0.09
127 0.08
128 0.08
129 0.09
130 0.07
131 0.07
132 0.07
133 0.07
134 0.09
135 0.1
136 0.1
137 0.1
138 0.1
139 0.1
140 0.09
141 0.08
142 0.07
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.08
149 0.11
150 0.11
151 0.13
152 0.14
153 0.14
154 0.15
155 0.15
156 0.13
157 0.1
158 0.1
159 0.09
160 0.14
161 0.14
162 0.13
163 0.17
164 0.16
165 0.19
166 0.23
167 0.27
168 0.25